Detailed information on CNT30446741


BLAST search results

BLAST vs Swiss-Prot:
sp|Q06398|GSTU6_ORYSJ, E-value = 2e-47

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30694750Saccharum spontaneumOryza sativa16.1725.3687.3271forward
CNT30178651Saccharum spontaneumSecale cereale26.256.9383.48115forward
CNT30249812Saccharum spontaneumAvena sativa26.4215.1484.48116forward
CNT30667524Saccharum spontaneumTriticum dicoccoides69.0251.3681.19303forward
CNT30685086Saccharum spontaneumTriticum urartu21.6424.891.5895forward
CNT30116875Saccharum spontaneumOryza nivara28.2550.8291.94124forward

Expression of CNT30446741

Peptides detected in this lncRNA

>peptide 1 (83 aa)
MDEHGYLLVDGIGLEKELALVPEILLDVLVAQALEAERELHPQHERARPHAQQLQVVSSGHCWSCRVSVMFYECLFFRWLNSW*

>peptide 2 (30 aa)
GRFEAMRTYLVIDVGGPEASNGAFVGVSRE*

>peptide 3 (44 aa)
MYCRMISDSETGFPLWMSTGTFWWTGLDLRRSSLLSLRSSSTYS*

Sequence

>CNT30446741
GGAAGATTTGAAGCGATGCGTACGTACCTTGTCATCGATGTAGGCGGCCCAGAAGCGAGCAATGGCGCGTTCGTAGGGGTCAGCAGGGAGTAGGGACGGG
CCGGTGCCGGCAAAGGCCTCGTCGATGTATTGCAGGATGATCAGCGATTCAGAGACGGGCTTCCCGTTATGGATGAGCACGGGTACCTTTTGGTGGACGG
GATTGGACTTGAGAAGGAGCTCGCTCTTGTCCCTGAGATCCTCCTCGACGTACTCGTAGCTCAGGCCCTTGAGGCTGAGCGCGAGCTTCACCCGCAGCAC
GAACGGGCTCGCCCACATGCCCAGCAGCTTCAGGTCGTCTCCTCCGGCCATTGCTGGAGCTGCAGGGTCTCAGTAATGTTCTACGAGTGCCTTTTTTTTC
GTTGGCTTAATTCTTGGTGATTGGGGAGGGAAGTGACGG