Detailed information on CNT30446140


BLAST search results

BLAST vs Swiss-Prot:
sp|Q9ASR1|EF2_ARATH, E-value = 0.0

BLAST vs NONCODE:
NONSLYT002586, E-value = 4e-80

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30547410Saccharum spontaneumIpomoea triloba23.3954.0581.18287forward
CNT30312884Saccharum spontaneumCamelina sativa72.3787.8382.32888forward
CNT30212259Saccharum spontaneumHelianthus annuus52.2496.179.25641forward

Expression of CNT30446140

Peptides detected in this lncRNA

>peptide 1 (32 aa)
MRRAAVTSEEKSTCPGESIRLIRYWLPSLSPL*

>peptide 2 (63 aa)
LVRCWNHLRNIQHKRTLRITVSDSSCIDVIKGSLVQVLHTILLSLCRGRKVEYHHLEQCSASW*

>peptide 3 (29 aa)
MVTLSFCSMGHNFSFWSFMQVLMICLIGS*

>peptide 4 (30 aa)
MRTSPATSWAIIPAAATRESVSVDLPAKNQ*

Sequence

>CNT30446140
CCCTTGTCAGATGCTGGAATCATCTTCGAAACATACAGCATAAGAGGACCCTCCGGATCACAGTTTCTGATAGCAGTTGCATAGACGTCATCAAGGGGTC
CCTCGTACAAGTTCTCCACACGATACTTTTGAGCCTTTGCCGGGGAAGGAAGGTGGAATATCATCATCTCGAGCAGTGCAGTGCTAGCTGGTAGCCACGT
TTGCATAACACGCTTCATCAAAGCTTTGCCAATCAATTCCTTCTCATCAGCCTTCATGGTAACATTGAGCTTTTGCAGCATGGGCCACAATTTCTCCTTC
TGGTCGTTCATGCAGGTGTTGATGATTTGCTTGATTGGCTCATAGCAGAACTGAACAAATCCTCTCTTGCAGGTAGGAGAGCCTGTGTTCTTGGTGGTCC
ACTTCTTGGTGGCAGGGTCAAAGAAGTTCTCACCCCAAAGCCTCTCCATCATCTTAGCTTCATCAACTCCAAACTTAGACGCATACATCTTCGCAAAGTT
AGTGAGGGTAAAGGCCCATCCGTGCAGGCCAGCAGAAAAAGCAACGGTGCCCTTCTCTGGGTAGACTTGGACATCACCAAGGAGCTTATCTTCATATGTT
GCCATGATGACATTGGCATTCTCAATGACACGGGAGAAAGTCTGGTAAGCTTCCTCGCCCTCAACCTGAAGCTCAAGGAAGCACCTGTCCATCTTGTTCA
CGGTAAGAACTGGCCTAATCCTCTCACCAAGGGCTTGGCGAAGCACAGTTTCAGTTTGCACACAGACACCTTCAATACAGTCAACCACCACCAGAGCACC
ATCGGTGATGCGAAGAGCAGCTGTGACTTCCGAAGAAAAATCAACGTGCCCAGGCGAGTCAATAAGGTTGATCAGGTATTGGTTACCATCTCTCTCGCCC
TTGTAATTCTTCAGTGACTCATCAGTCATCTCATAGTAAAGAGAGATACCAGTAGATTTGATTGTAATACCGCGCTCTGCCTCATCTGCACGAGTATCAG
TCATGCGAACATCGCCAGCAACTTCCTGGGCAATAATACCAGCAGCTGCCACAAGGGAATCTGTAAGCGTAGACTTGCCTGCAAAGAATCAATAATAGCA
TATTAGAACGGTGTGGAACTTCAACATGTGCAACATAGAGTAGTACAACTAACAGATACTATATAAAACACAATACCTAGAGAACCAGTACATAAATTAC
AAGATGACAAAAGGATAAGCCCATTTC