Detailed information on CNT30445727


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30677893Saccharum spontaneumSetaria viridis8.8746.0287.5104forward
CNT30522282Saccharum spontaneumSetaria italica17.6525.7591.3207forward
CNT30394844Saccharum spontaneumTriticum turgidum16.5426.8793.3194forward
CNT30588279Saccharum spontaneumMusa acuminata7.0828.8286.7583forward
CNT30347946Saccharum spontaneumEragrostis tef16.1124.2692.59189forward

Expression of CNT30445727

Peptides detected in this lncRNA

>peptide 1 (81 aa)
MQLYSERRAQGHRAASARGHVVTWGRPRPPPPRPRPCCGRLRPWRRSRRPRAPPPRAGSCRPRRRRRPGSAGTRARRRRRA*

>peptide 2 (65 aa)
MVLGASFGFAVGHGSGPLGDVYPPAVARRPVIFLGPGVATDHSSHPTCAPCCCCCRIFGSIHFSL*

Sequence

>CNT30445727
TGTTAAGTGGTGCTGTAGCACACAAGAAAATGAAGTGAAGGAATGAACGTTTGTATGCAAAACCACTGAAATTATTTTGACAAGTAGATATAATAGTACA
TTTTATACCGTTCACAAGTAGTATCAGTGATTTCTCTCAGCACCAGCGCCACCGGCCTGCTGGCTTCTCGTGGTTACGTATACCGTACACGTGCAGCGGC
ACATCGACTGCCACGTAGGGCAAACTATGCAGTTATACAGCGAGCGCAGAGCACAAGGCCACCGCGCCGCGTCGGCACGTGGACACGTCGTCACTTGGGG
CCGGCCGAGGCCGCCTCCGCCTCGGCCTCGGCCTTGCTGCGGTCGGCTTCGACCCTGGCGGCGATCTCGGCGGCCTCGTGCTCCGCCGCCTCGAGCAGGA
AGCTGCCGCCCTCGTCGTCGACGGCGACCTGGATCGGCTGGGACCCGAGCCCGTCGGCGACGGCGAGCATGATGCGGCGCATCTCGTCGCGGAACTCGGC
GCGGTCGACGGCGCCGCTGCCGTCGGCGTCGAACTGCTCGAAGACGGCGTCGTAGAGCGCGGCGACGTCGGCGGGGAGCGGCGGAACGACTCGAGCGCGC
GGCGGAGCTCGGCGCGGGACAGCACGCCGTCGCCGTTGGCGTCCAGCGCCGCGAAGCGCGCGTCCACGCTGCGCGCGAAGGCGGGCTCGTCCGCCACGAA
CCCGCGCACCGTCGACCCGTCCAGGACCACCACGCTCATGATGGTCTCTTGATCTCTTCTCCTCCTGCTGGGTGGTGGAGGCTAGAGCTGGAGACTGGAG
AGCGGAGAGAATACTGTAACGGAGACTGGAGAGCGGCTTGGTTTGGTGATTGGTCGCTTTAAATTTGATGATTGATGGTGCTCGGTGCTTCCTTTGGTTT
CGCGGTTGGGCACGGCTCGGGGCCTTTGGGTGATGTTTATCCTCCAGCAGTTGCTCGCCGCCCCGTGATATTTTTGGGTCCGGGTGTGGCCACTGATCAC
TCGTCTCATCCCACGTGCGCCCCTTGTTGTTGTTGTTGTCGGATTTTTGGCTCGATTCACTTCTCTCTTTAAGCATCTCTGTCGGTAGTACTTTTTGTAT
AGCTAATATAAGCCAGTCCACCGTGTGCTAGCGAGTAGAAACTACTAGTAGCATGGTAAACAGACGATGCGAG