Detailed information on CNT304455


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONZMAT003838, E-value = 6e-17

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30520592Zea maysSetaria italica37.6317.3987.96108forward
CNT30394727Zea maysTriticum turgidum77.79.8986.55223forward
CNT30554834Zea maysOryza glaberrima77.77.3185.2223forward
CNT30450881Zea maysSaccharum spontaneum77.720.5393.72223forward
CNT30117540Zea maysOryza nivara77.738.6587.44223forward

Expression of CNT304455

Peptides detected in this lncRNA

>peptide 1 (94 aa)
PLADEQVLGPVRVVVAQDVPVGGHPARHVPGHDVAHAVHERHGVVADGEAVAQVDVVAGPGAQLRHQRRHAQVRVRLPVVHVLRAVQHQHVAVAP

>peptide 2 (39 aa)
ATCRRAGPRARACRCGAGCPRWRTPSAPRPRTRRSPCRA*

>peptide 3 (34 aa)
SHLPTSRSSGPCVSLWRRMSPLADTQRATSQDTT*

Sequence

>CNT304455
AGCCACTTGCCGACGAGCAGGTCCTCGGGCCCGTGCGTGTCGTTGTGGCGCAGGATGTCCCCGTTGGCGGACACCCAGCGCGCCACGTCCCAGGACACGA
CGTAGCCCATGCCGTGCATGAACGGCATGGGGTCGTCGCCGACGGGGAAGCCGTAGCCCAGGTAGACGTCGTCGCGGGGCCTGGGGCGCAGCTCCGCCAC
CAGCGCCGCCACGCGCAGGTACGCGTGCGTCTTCCCGTCGTTCATGTTCTCCGCGCAGTCCAGCACCAGCACGTCGCCGTGGCGCCG