Detailed information on CNT30445384


BLAST search results

BLAST vs Swiss-Prot:
sp|Q9LJE5|ECT2_ARATH, E-value = 4e-06

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30678232Saccharum spontaneumSetaria viridis42.5368.4993.61313forward
CNT30296885Saccharum spontaneumTriticum aestivum35.8761.1185.23264forward
CNT30392043Saccharum spontaneumTriticum turgidum35.8754.8985.23264forward
CNT30343957Saccharum spontaneumEragrostis tef43.4879.490.94320forward
CNT30361764Saccharum spontaneumSorghum bicolor52.5847.8496.12387forward
CNT30107871Saccharum spontaneumOryza longistaminata37.9155.9190.68279forward
CNT30575834Saccharum spontaneumOryza barthii32.7467.3288.8241forward

Expression of CNT30445384

Peptides detected in this lncRNA

>peptide 1 (68 aa)
MHKQSHHTMQSVPLCCHTHKSCPGNQQKELHLARVPYKFHQASVMNFVGLTQGVQFHCYCEQYHLEHC*

>peptide 2 (35 aa)
MLRTKHLTINRWNWGSGRRVCPIRSIPISINISIYC

Sequence

>CNT30445384
CCATCTGCTGTGTGGTGGAGCTCATGTTCTGATTTCTTGCTGAGGAACCATTCCCACTGAATGTTGAGGATGGATAATGATTAGTTGTAGTTGTTCTTTG
CTGCGTCAGTGATGAATTTTGTTGGCTTGACGCAAGGGGTACAGTTCCACTGTTACTGTGAGCAGTACCATTTGGAACACTGTTAGTGGTTGTCTTGGCA
GGATCTGCTTTAGCTGCTGGCTTTTCAGGATTGTTAGAAGACTGGAGGTCGCTTTGAGTGGTAGAAGGAACTGTTGTAGTTGTTCTTTGCTGTCCAGATG
CATAAGCAGAGCCATCATACCATGCAAAGTGTGCCCCTGTGCTGTCATACCCATAAGTCGTGTCCAGGTAACCAGCAGAAGGAACTCCACCTAGCAAGGG
TGCCCTATAAGTTCCATCAGGCGTCAGTGATGAATTTTGTTGGCTTGACGCAAGGGGTACAGTTCCACTGTTACTGTGAGCAGTACCATTTGGAACACTG
TTAGCGGTTGTCTTGGCAGGATCTGCTTTAGCTGCTGGCTTTTCAGGATTGTTAGAAGACTGGAGGTCGCTTTGAGTGGTAGAAGGAACTGGTGTAGGAG
GCTGAAAGTACGCAGTTGGATACTGGTAATGCTGCGCACCAAACATCTGACCATCAACCGTTGGAACTGGGGAAGTGGCAGGAGAGTATGCCCCATAAGG
AGCATACCCATATCCATAAATATCTCCATATACTGC