Detailed information on CNT30445279


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30696704Saccharum spontaneumOryza sativa24.6644.7286.81144forward
CNT30522415Saccharum spontaneumSetaria italica49.8386.8791.07291reverse complement
CNT30379183Saccharum spontaneumManihot esculenta13.8728.5288.8981forward
CNT30185797Saccharum spontaneumSecale cereale12.8430.8693.3375reverse complement
CNT30294691Saccharum spontaneumTriticum aestivum12.8424.6794.6775reverse complement
CNT30227081Saccharum spontaneumHordeum vulgare12.8425.3494.6775reverse complement
CNT30391653Saccharum spontaneumTriticum turgidum12.8424.8394.6775reverse complement
CNT30552322Saccharum spontaneumOryza glaberrima26.249.0486.93153reverse complement
CNT30443397Saccharum spontaneumAegilops tauschii13.8726.6492.5981reverse complement
CNT30662530Saccharum spontaneumTriticum dicoccoides12.8422.0694.6775reverse complement
CNT30130300Saccharum spontaneumLolium perenne25.6851.986150forward
CNT3015222Saccharum spontaneumZea mays49.8398.3188.66291reverse complement
CNT3067608Saccharum spontaneumLeersia perrieri15.5829.5591.2191reverse complement
CNT30689291Saccharum spontaneumTriticum urartu12.8422.3993.3375reverse complement
CNT30339265Saccharum spontaneumEragrostis tef48.2988.1290.43282forward
CNT30361740Saccharum spontaneumSorghum bicolor50.1796.0789.08293reverse complement
CNT30596008Saccharum spontaneumOryza meridionalis12.3323.395.8372reverse complement
CNT30369785Saccharum spontaneumOryza glumipatula26.5439.7485.81155forward
CNT30108933Saccharum spontaneumOryza longistaminata26.249.3586.93153reverse complement
CNT30150512Saccharum spontaneumBrachypodium distachyon17.2933.1189.11101reverse complement
CNT30102085Saccharum spontaneumOryza rufipogon28.7730.5585.12168reverse complement
CNT30574593Saccharum spontaneumOryza barthii26.249.0486.93153reverse complement
CNT30117631Saccharum spontaneumOryza nivara24.6644.5886.81144reverse complement
CNT30603809Saccharum spontaneumOryza punctata12.3323.4595.8372reverse complement
CNT30550736Saccharum spontaneumOryza brachyantha13.0124.6892.1176reverse complement

Expression of CNT30445279

Peptides detected in this lncRNA

>peptide 1 (53 aa)
AGEDEIPAASSVKEQMYKIARAQEHLGSGSPPGRMYQASARPVPRSSNPLHNR*

>peptide 2 (51 aa)
RWRRRDTGGVFSEGADVQNSKSARTSWQWLSSRPNVSSVCKASASKLKSPA*

>peptide 3 (29 aa)
MVVCQRGCLGLRRAWSAAACYPPTVGSGR*

Sequence

>CNT30445279
CGCTGGAGAAGACGAGATACCGGCGGCGTCTTCAGTGAAGGAGCAGATGTACAAAATAGCAAGAGCGCAAGAACATCTTGGCAGTGGCTCTCCTCCCGGC
CGAATGTATCAAGCGTCTGCAAGGCCAGTGCCTCGAAGCTCAAATCCCCTGCATAATCGATAGTTCAGGCTGTTCACGACGGTGATAAGAGATGCCTCGC
CGGTGGCTTCGCTGAACGCTGGTTGGACAAAAGGGCCTGGCAGTGGCAGACGACTGGGGAGGAAGAAAAGGAGGGAAATAGCAAAAAAAAATGGTGGTCT
GCCAGAGAGGGTGCTTGGGCCTTAGGCGGGCCTGGAGTGCAGCGGCCTGTTATCCTCCCACCGTTGGAAGCGGGCGGTAATCGCTGCTCTGTGAAGCCAG
CCTCACGCATTGCCCGCCGCTCTAGGTGCCGGGACACCAAGGCTTTCGCCAAAGCACCCGCAGCCCACTACGCAACTTGGAACGGGCAGGCCGCAGATTG
CAGCACCAAGCCCAGGTCCAAGCGCCACAATTGGCATCCACACCACCTTGTTGCCCCCGCTCGGGTTACAAGCAGTCGCTACCT