Detailed information on CNT30445203


BLAST search results

BLAST vs Swiss-Prot:
sp|P69309|UBIQP_AVEFA, E-value = 7e-156

BLAST vs NONCODE:
NONMEST001181, E-value = 4e-117

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30672296Saccharum spontaneumSetaria viridis53.1185.189.15691forward
CNT30669573Saccharum spontaneumTriticum dicoccoides53.2770.6489.03693forward
CNT30141487Saccharum spontaneumLolium perenne53.2775.4189.47693forward
CNT30576634Saccharum spontaneumOryza barthii53.564.8689.8696forward
CNT30583334Saccharum spontaneumEchinochloa crusgalli53.4232.3387.48695forward

Expression of CNT30445203

Peptides detected in this lncRNA

>peptide 1 (66 aa)
MFCGETWTQETLTSHRRQTELSNLDTRDLISHQTRQTELSNPTIPDLYWPPRRRRTRWSVDSFWML*

>peptide 2 (91 aa)
MTDNPCHSAYKHTQSMNISLPGNFPHKKKVAITVRSADQLKRKMTETNSVCQDKNHVHLSITVIKLLQRKAAYVLRRNLDTRDSDLTSATN*

>peptide 3 (30 aa)
MVFPVRVFTKICMPPLSLSTRWRVDSFWML*

>peptide 4 (34 aa)
MPRQKPCSLIHYGNQAATKKGSICFAEKLGHKRL*

>peptide 5 (50 aa)
MPSLSWIFAFTLSIVSDDSTSRVIVLPVSVFTKICIPPRSRSTKWRVDSF*

>peptide 6 (51 aa)
MVLPVRVFTKICICRDKNHMVSYHKEKGAEKTSALKRMVQISTMKQWYQQTE

Sequence

>CNT30445203
GCTTACTCGTCAACCAGTATTACAGTGAAATGGCAGTGCATTGGTATTAATTTCAAATAGAGTATATTCATTGAAGTAGAACTCTTGTGTTCATTTCAGA
CTATCTGAAGGTCAAATTTCTGGCGATACTTGTCGTATGACAGATAACCCATGTCACTCAGCATATAAACACACACAATCAATGAATATAAGTTTACCAG
GCAATTTTCCTCATAAAAAAAAGGTAGCAATCACAGTGAGATCAGCAGACCAGCTAAAACGCAAAATGACAGAAACAAATTCTGTATGCCAAGACAAAAA
CCATGTTCACTTATCCATTACGGTAATCAAGCTGCTACAAAGAAAGGCAGCATATGTTTTGCGGAGAAACTTGGACACAAGAGACTCTGACCTCACATCG
GCGACAAACTGAACTCAGTAACTTGGACACAAGAGACTTGATCTCACATCAGACACGACAAACTGAACTCAGTAACCCAACCATCCCAGACCTTTACTGG
CCACCACGGAGGCGCAGAACCAGGTGGAGTGTGGACTCCTTCTGGATGTTGTAATCCGCCAGGGTGCGGCCGTCCTCAAGCTGCTTACCAGCAAAGATCA
GGCGCTGCTGGTCCGGCGGGATGCCCTCCTTATCCTGGATCTTTGCCTTCACGTTGTCGATCGTGTCAGACGACTCAACCTCCAGGGTGATTGTCTTGCC
AGTCAGCGTCTTCACAAAGATCTGCATACCACCTCGGAGCCGGAGCACCAAGTGGAGGGTGGACTCCTTCTGAATGTTGTAGTCAGCAAGAGTGCGGCCA
TCCTCAAGTTGCTTTCCAGCAAAGATGAGGCGCTGCTGGTCTGGTGGAATGCCCTCCTTGTCTTGAATCTTGGCCTTCACATTGTCAATCGTGTCTGAGG
TCTCGACCTCCAGTGTGATGGTCTTTCCAGTAAGGGTCTTCACAAAGATCTGCATGCCACCCCTGAGCCTGAGCACAAGGTGGAGGGTAGACTCCTTCTG
GATGTTATAGTCAGCGAGTGTCCGCCCATCTTCGAGCTGCTTGCCAGCAAAGATCAGACGCTGCTGATCCGGTGGGATTCCCTCCTTGTCCTGGATCTTT
GCCTTGACATTGTCAATTGTGTCCGAGGACTCAACCTCGAGGGTGATGGTCTTGCCCGTGAGAGTCTTCACAAAGATCTGCATCTGCAGAGACAAAAATC
ACATGGTAAGCTACCATAAAGAGAAAGGCGCTGAAAAAACTAGTGCTTTGAAAAGAATGGTTCAAATCTCAACTATGAAACAGTGGTACCAACAAACGGA
G