Detailed information on CNT30444399


BLAST search results

BLAST vs Swiss-Prot:
sp|Q76H85|H4_SILLA, E-value = 1e-33

BLAST vs NONCODE:
NONGMAT001327, E-value = 2e-43

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30671259Saccharum spontaneumSetaria viridis43.4663.3397.3259forward
CNT30317753Saccharum spontaneumCorylus avellana47.8240.9582.81285forward
CNT30375418Saccharum spontaneumArabidopsis thaliana14.7737.2988.6488forward
CNT30196946Saccharum spontaneumPisum sativum24.520.3981.51146forward
CNT3059678Saccharum spontaneumArabidopsis lyrata22.4827.8685.07134forward
CNT30348363Saccharum spontaneumEragrostis tef52.8556.5596.51315forward
CNT30370989Saccharum spontaneumOryza glumipatula47.6545.4495.07284forward
CNT30581397Saccharum spontaneumEchinochloa crusgalli36.4136.9794.47217forward

Expression of CNT30444399

Peptides detected in this lncRNA

>peptide 1 (71 aa)
MRFTPPLLASLPDRRLRDALDVVAEHLPVALGAALAQALASLAAARHGCLLLRDERAGGCWRSGDLRPRSVG

>peptide 2 (48 aa)
MPWMLSRSTFRWRLAPPLPRPLPPLPRPDMAACCFETNGQEAAGGAEI*

>peptide 3 (84 aa)
MAGGRGRSQGSAAETVEGAALALERVDDIHGGDGLAAGVLRVGDGVADDVLEEDLEHAASLLVDQPGDALHAAPPRQPPRSPAS*

Sequence

>CNT30444399
CTCCGTTACAAACATAAACACTAAGCACAGCGCAGACCCAACACAAAGTCACAAACTCCCCTAATCCATCAGCAACCCTAGCTAGCACCTGACCACTAAG
CACAGTGCAGACCCAACAAAGTCACAAACTCCCCCCCTAATCCATCAGCAACCCTAGCAAGCACCTGACCACAACCACATGGCCGGAGGACGCGGACGGA
GCCAAGGCTCAGCCGCCGAAACCGTAGAGGGTGCGGCCCTGGCGCTTGAGCGCGTAGACGACATCCATGGCGGTGACGGTCTTGCGGCGGGCGTGCTCCG
TGTAGGTGACGGCGTCGCGGATGACGTTCTCGAGGAAGATCTTGAGCACGCCGCGAGTCTCCTCGTAGATCAGCCCGGAGATGCGCTTCACGCCGCCCCT
CCTCGCCAGCCTCCCCGATCGCCGGCTTCGTGATGCCCTGGATGTTGTCGCGGAGCACCTTCCGGTGGCGCTTGGCGCCGCCCTTGCCCAGGCCCTTGCC
TCCCTTGCCGCGGCCCGACATGGCTGCCTGCTGCTTCGAGACGAACGGGCAGGAGGCTGCTGGAGGAGCGGAGATTTGAGGCCTCGATCCGTGGGA