Detailed information on CNT30434220


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30493035Papaver somniferumOlea europaea25.0610.6683.5103forward

Expression of CNT30434220

Peptides detected in this lncRNA

>peptide 1 (29 aa)
MTRSIRSGTRHLFLLFNSLTTRKNHCSTL*

>peptide 2 (47 aa)
MKIDGECLIELIGSCRNKVQVYRSVRMPQLHTSLHFHLTPIVMINDSS

>peptide 3 (55 aa)
MKNQKLCPPSLSKGWKGRAFGFSCCQRVEQWFFRVVKELNNENRWRVPDRIDRVM*

Sequence

>CNT30434220
GTATGCAGCTGAGGCATCCTAACAGACCGATAGACTTGAACCTTGTTCCTACATGACCCGATCAATTCGATCAGGCACTCGCCATCTATTTTTATTGTTC
AACTCTTTGACAACACGAAAAAACCATTGTTCAACTCTTTGACAGCATGAAAAACCAAAAGCTCTGCCCTCCCTCTCTATCCAAGGGATGGAAGGGCAGA
GCTTTTGGTTTTTCATGTTGTCAAAGAGTTGAACAATGGTTTTTTCGTGTTGTCAAAGAGTTGAACAATGAAAATAGATGGCGAGTGCCTGATCGAATTG
ATCGGGTCATGTAGGAACAAGGTTCAAGTCTATCGGTCTGTTAGGATGCCTCAGCTGCATACATCACTGCATTTCCACTTGACACCTATCGTAATGATAA
ACGACTCATCT