Detailed information on CNT30434116


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONCSAT001427, E-value = 1e-145

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT30434116

Peptides detected in this lncRNA

>peptide 1 (44 aa)
MLSQLFVFHKSKNFASDYEIRMPPTVPVNHYSDPEGQRNRTEIL*

>peptide 2 (44 aa)
MHPFQKSGFVARISSRITTVIRVASTIKQTITDLMSHSQFHSLN*

>peptide 3 (42 aa)
MALGPPDFQGPPGAHRTPRDVRCSSGRWTLPPAEPFPGWAGR*

>peptide 4 (40 aa)
MMLSHANVSRAWACFEHSNFFKVTAPEARPGQLRLGTHRR*

>peptide 5 (61 aa)
SPWRPDAVMSTTGRGWHSVLRIFKGRRGRTGHHATCGALPAAGPYLRLNRFQGGQAVKQKR*

>peptide 6 (47 aa)
MAHLELSIPWRGSLEQPRRPTYLKFENRSRALRPVSGPGKFPRVWTW*

>peptide 7 (47 aa)
MMRRQHKGRAIRQVIMNHLRLLSNKCIPSRSRGLLHVLALELLRLSE*

>peptide 8 (33 aa)
MEPFPLRPSKFSFEYLLLPPRSAPTEAPPGLTA*

>peptide 9 (32 aa)
MKYECPRLSLLIITPIPKANAIGPKSYDVIPC*

Sequence

>CNT30434116
TTCACCTTGGAGACCTGATGCGGTTATGAGTACGACCGGGCGTGGATGGCACTCGGTCCTCCGGATTTTCAAGGGCCGCCGGGGGCGCACCGGACACCAC
GCGACGTGCGGTGCTCTTCCGGCCGCTGGACCCTACCTCCGGCTGAACCGTTTCCAGGGTGGGCAGGCCGTTAAACAGAAAAGATAACTCTTTCCGAGGC
CCCCGCCGACGTCTCCGGACTCCCTAACGTTGCCGTCAGCCGCCACGTCCCGGTTCAGGAATTTTAACCCGATTCCCTTTCGAAGTTCGCGTGTTGCACG
CTCTCTGACGGGCTTCCCCCGTCTCTTAGGATCGACTAACCCATGTGCAAGTGCCGTTCACATGGAACCTTTCCCTCTTCGGCCTTCAAAGTTCTCATTT
GAATATTTGCTACTACCACCAAGATCTGCACCGACGGAGGCTCCGCCCGGCCTCACGGCCTAGGTTTCGCAGCCACCGCCGCGCCCTCCTACTCATCGGG
GCCTAACGATTGCCCCGACGGCCGGGTGTGGGTCGCGCGCTTCAGCGCCATCCATTTTCGGGGCTAGTTGATTCGGCAGGTGAGTTGTTACACACTCCTT
AGCGGATTTCGACTTCCATGACCACCGTCCTGCTGTCTTAATCGACCAACACCCTTTGTGGGTTCTAGGTTAGCGCGCAGTTGGGCACCGTAACCCGGCT
TCCGGTTCATCCCGCATCGCCAGTTCTGCTTACCAAAAATGGCCCACTTGGAGCTCTCGATTCCGTGGCGCGGCTCATTGGAGCAGCCGCGCCGTCCTAC
CTATTTAAAGTTTGAGAATAGGTCGAGGGCGTTGCGCCCCGTGTCTGGACCTGGTAAGTTTCCCCGTGTCTGGACCTGGTAAGAGCTCTCAGTCTGTCAA
TCCTTACTATGTCTGGACCTGGTAAGTTTCCCCGTGTTGAGTCAAATTAAGCCGCAGGCTCCACTCCTGGTGGTGCCCTTCCGTCAATTCCTTTAAGTTT
CAGCCTTGCGACCATACTCCCCCCGGAACCCAAAAACTTTGATTTCTCATAAGGTGCCGGCGGAGTCCTAAAAGCAACATCCGCCGATCCCTGGTCGGCA
TCGTTTATGGTTGAGACTAGGACGGTATCTGATCGTCTTCGAGCCCCCAACTTTCGTTCTTGATTAATGAAAACATCCTTGGCAAATGCTTTCGCAGTTG
TTCGTCTTTCATAAATCCAAGAATTTCGCCTCTGACTATGAAATACGAATGCCCCCGACTGTCCCTGTTAATCATTACTCCGATCCCGAAGGCCAACGCA
ATAGGACCGAAATCCTATGATGTTATCCCATGCTAATGTATCCAGAGCTTGGGCTTGCTTTGAGCACTCTAATTTCTTCAAAGTAACAGCACCGGAGGCA
CGACCCGGCCAATTAAGGCTAGGAACGCATCGCCGGTAGAAGGGAGAGACGACCGGTGCACACCCAAAGGGCGGACCGGACGACCCAACCCAAAGTCCAA
CTACGAGCTTTTTAACTGCAACAACTTAAATATACGCTATTGGAGCTGGAATTACCGCGGCTGCTGGCACCAGACTTGCCCTCCAATGGATCCTCGTTAA
GGGATTTAGATTGTACTCATTCCAATTACCAGACTCGAAGAGCCCGGTATTGTTATTTATTGTCACTACCTCCCCGTGTTAGGATTGGGTAATTTGCGCG
CCTGCTGCCTTCCTTGGATGTGGTAGCCGTTTCTCCGGCTCCCTCTCCGGAATCGAACCCTAATTCTCCGTCACCCGTCACCACCATAGTAGGCCACTAT
CCTATCATCGAAAGTTGATAGGGCAGAAATTTGAATGATGCGTCGCCAGCACAAAGGCCGTGCGATCCGTCAAGTTATCATGAATCATCTGAGACTTTTA
TCTAATAAATGCATCCCTTCCAGAAGTCGGGGTTTGTTGCACGTATTAGCTCTAGAATTACTACGGTTATCCGAGTAGCAAGTACCATCAAACAAACTAT
AACCGATTTAATGAGCCATTCGCAGTTTCACAGTCTGAATTAGTTCATACTTACACATGCATGGCTTAATCTTTGAGACAAGCATATGACTACTGGCAGG