Detailed information on CNT30434082


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONCQUT001030, E-value = 0.0

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT30434082

Peptides detected in this lncRNA

>peptide 1 (29 aa)
MPLGTRRSLLQVGNRATGACAASLAWILT*

>peptide 2 (44 aa)
MRRFFSLDSDLEAFSHNPAHGSFAPLAFQPSAMTNCVNQRFLSY*

>peptide 3 (58 aa)
PVAYLSRLQRILPATRWDESVRHGAESQWIVAARPLCHLQYPVAYLSRLQRILPATRW*

>peptide 4 (99 aa)
MIGRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSFKFRRSKGSIGHAFTVRIRTGNQNQTSFYPFVPHEISVLVELILGHLRYLLTDVPPQPNSPPDNV

Sequence

>CNT30434082
CCCCGTCGCGTATTTAAGTCGTCTGCAAAGGATTCTACCCGCCACCCGGTGGGACGAATCGGTGCGACATGGGGCTGAATCTCAGTGGATCGTGGCAGCA
AGGCCACTCTGCCACTTACAATACCCCGTCGCGTATTTAAGTCGTCTGCAAAGGATTCTACCCGCCACCCGGTGGTAATAGTACTTCAGGGCGGCCCGCG
CAGCTCGTCCGCTGCGAGGGCTACGCCCACGGCACATGCCTCTGGGGACCCGAAGGTCCCTACTGCAGGTCGGCAATCGGGCGACGGGCGCATGCGCCGC
TTCTTTAGCCTGGATTCTGACTTAGAGGCGTTTAGTCATAATCCTGCACACGGTAGCTTCGCGCCACTGGCTTTTCAACCAAGCGCGATGACCAATTGTG
TGAATCAACGGTTCCTCTCGTACTAGGTTGAATTACTATCGCGGCACTGTCATCAGTAGGGTAAAACTAGCCTGTCTCACGACGGTCTAAACCCAGCTCA
CGTTCCCTATTGGTGGGTGAACAATCCAACACTTGGTGAATTCTGCTTCACAATGATAGGAAGAGCCGACATCGAAGGATCAAAAAGCAACGTCGCTATG
AACGCTTGGCTGCCACAAGCCAGTTATCCCTGTGGTAACTTTTCTGACACCTCTAGCTTCAAATTCCGAAGGTCTAAAGGATCGATAGGCCACGCTTTCA
CGGTTCGTATTCGTACTGGAAATCAGAATCAAACGAGCTTTTACCCTTTTGTTCCACACGAGATTTCTGTTCTCGTTGAGCTCATCTTAGGACACCTGCG
TTATCTTTTAACAGATGTGCCGCCCCAGCCAAACTCCCCACCTGACAATGTCT