Detailed information on CNT30434041


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONCQUT004405, E-value = 0.0

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT30434041

Peptides detected in this lncRNA

>peptide 1 (47 aa)
MSDSLVRVSRRAEWGTHRPTPGARCCRRHAVRRVLPTTIETTTSPRA*

>peptide 2 (37 aa)
MAHLELSIPWRGSMEQPRRPTYLKFENRSRALRPRCL*

>peptide 3 (88 aa)
MLSLEPFTEDLGRSAVQPTRGSRQSASLRLTGFTRPWTRTHVRLLGPCFKTGRMGNPQADAGSTLLPEARREARAAHHDRDDDVSAGMT

>peptide 4 (54 aa)
MCKCRSHGTFPLFGLQSSHLNICYYHQDLHRRRLRPASWPRFRSHRRALLLIGA*

Sequence

>CNT30434041
GCTGGACCCTACCTCCGGCTGAACCGTTTCCAGGGTGGGCAGGCCGTTAAACAGAAAAGATAACTCTTTCCGAGGCCCCCGCCGACGTCTCCGGACTCCC
TAACGTTGCCGTCAGCCGCCACGTCCCGGTTCAGGAATTTTAACCCGATTCCCTTTCGAAGTTCGCGTGTTGCACGCTCTCTGACGGGCTTCCCCCGTCT
CTTAGGATCGACTAACCCATGTGCAAGTGCCGTTCACATGGAACCTTTCCCCTCTTCGGCCTTCAAAGTTCTCATTTGAATATTTGCTACTACCACCAAG
ATCTGCACCGACGGAGGCTCCGCCCGGCCTCATGGCCTAGGTTTCGCAGCCACCGCCGCGCCCTCCTACTCATCGGGGCCTAACGATTGCCCCGACGGCC
GGGTGTGGGTCGCGCGCTTCAGCGCCATCCATTTTCGGGGCTAGTTGATTCGGCAGGTGAGTTGTTACACACTCCTTAGCGGATTTCGACTTCCATGACC
ACCGTCCTGCTGTCTTAATCGACCAACAACCTTTGTGGGTTCTAGGTTAGCGCGCAGTTGGGCACCGTAACCCGGCTTCCGGTTCATCCCGCATCGCCAG
TTCTGCTTACCAAAAATGGCCCACTTGGAGCTCTCGATTCCGTGGCGCGGCTCAATGGAGCAGCCGCGCCGTCCTACCTATTTAAAGTTTGAGAATAGGT
CGAGGGCGTTGCGCCCCCGATGCCTCTAATCATTGGCTTTACCCGATAAAACTTGCCCGCGGGCTCCAGCTATCCTGAGGGAAACTTCGGAGGGAACCAG
CTACTAGACGGGAAACTTCGGAGGGAACCAGCTACTAGACGGTTCGATTAGTCTTTCGCCCCTATACCCAAGTCAGACGAACGATTTGCACGTCAGTATC
GCTGCGAGCCTCCACCAGAGTTTCCTCTGGCTTCGCCCCGCTCAGGCATAGTTCACCATCTTTCGGGTCCCGACAGGTATGCTCTCACTCGAACCCTTCA
CAGAAGATCTAGGTCGGTCGGCGGTGCAACCCACAAGGGGATCCCGCCAGTCAGCTTCCTTGCGCCTTACGGGTTTTACTCGCCCGTGGACTCGCACACA
TGTCAGACTCCTTGGTCCGTGTTTCAAGACGGGCCGAATGGGGAACCCACAGGCCGACGCCGGGAGCACGCTGTTGCCGGAGGCACGCCGTGAGGCGCGT
GCTGCCCACCACGATCGAGACGACGACGTCTCCGCGGGCATGACTAC