Detailed information on CNT30432837


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONCQUT004405, E-value = 7e-164

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT30432837

Peptides detected in this lncRNA

>peptide 1 (40 aa)
MQPKAGGKFRPRLNTGERPIANKYREGKMKRTLKRESKSA*

>peptide 2 (99 aa)
LPSRQFQALFDSLFKVFFIFPSRYLFAIGLLPVFSLGRNLPPALGCIPKQPDSPTAPRGATGSEHDGALTLSGATFQGTWARSIAEDASIDYNSDSEAV*

>peptide 3 (89 aa)
FPPDNFKHSLTLFSKSFSSFPRGTCSLSVSCQYLALDGIYRPLWAAFPNNPTRRQRLVVRQGPSTTGLSPSQAPLSRGLGPGPSLRTLL*

Sequence

>CNT30432837
GCTTCCCTCCCGACAATTTCAAGCACTCTTTGACTCTCTTTTCAAAGTCTTTTTCATCTTTCCCTCGCGGTACTTGTTCGCTATCGGTCTCTTGCCAGTA
TTTAGCCTTGGACGGAATTTACCGCCCGCTTTGGGCTGCATTCCCAAACAACCCGACTCGCCGACAGCGCCTCGTGGTGCGACAGGGTCCGAGCACGACG
GGGCTCTCACCCTCTCAGGCGCCACTTTCCAGGGGACTTGGGCCCGGTCCATCGCTGAGGACGCTTCTATAGACTACAATTCGGACAGCGAAGCCGTCTG
ATTCTCAAGTTGGGCTGTTCCCGGTTCGCTCGCCGTTACTAGGGGAATCCTTGTAAGTTTCTTCTCCTCCGCTTATTGATATGAGAAGAAACTTACAAGG
ATTCCCCTAGTAACGGCGAGCGAACCGGGAACATCCCAGCTTGAGAATCGGAAGGCTTCGCTGTCCGAATTGTAGTCTGTAGAAGCGTCCTCAGCGACGG
ACCGGGCCCAAGTCCCCTGGAAAGGGGCGCCTGAGAGGGTGAGATCCCCGTCGTGCTCGGACCCTGTCACACCACGAGGCGCTGTCGGCGAGTCGGGTTG
TTTGGGAATGCAGCCCAAAGCGGGCGGTAAATTCCGTCCAAGGCTAAATACTGGCGAGAGACCGATAGCGAACAAGTACCGCGAGGGAAAGATGAAAAGG
ACTTTGAAAAGAGAGTCAAAGAGTGCTTGAAATTGTCGGGAGGGAAGCGGATGGGGGCCG