Detailed information on CNT304300


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30697318Zea maysOryza sativa18.2936.6592.37118forward
CNT30676942Zea maysSetaria viridis18.2924.2396.61118forward
CNT30297243Zea maysTriticum aestivum16.4335.5793.4106forward
CNT30555270Zea maysOryza glaberrima17.2123.9793.69111forward
CNT30439786Zea maysAegilops tauschii16.4330.1193.4106forward
CNT30662749Zea maysTriticum dicoccoides17.3640.4392.86112forward
CNT30117872Zea maysOryza nivara17.8335.8394.78115forward

Expression of CNT304300

Peptides detected in this lncRNA

>peptide 1 (36 aa)
MTWHRCRLVARPHRLGVLSAAPEMTVSRLMGMLLPK*

>peptide 2 (92 aa)
MRRFLPPLDNVHAWAWHVLHFRPSHTALSPVKSRTAAAHDLASLPACGASSQAGRPLGGAGDDGEQVDGDAVAEIAEGVSVEEQGSGLHAFR*

>peptide 3 (36 aa)
QKKSSHYFLSIKHFTINSCLWKHSFGELRSKIQELY*

Sequence

>CNT304300
CTCAAAAAAAATCAAGCCACTATTTTCTGAGTATAAAACATTTCACGATTAATTCTTGTCTCTGGAAACACTCCTTTGGAGAATTAAGAAGTAAAATTCA
GGAGCTCTATTAGATTGACCACAAAGTAACTTAGGCTACGTTTGTTTCCTCCTATACGTTGAATTATACTAGAGGGGTAAAATATCACTTTAAAATCACA
AATAAGTTAAAATAAGCTAGCATTCACAAATAATCCAACTCAAACGCACCCTTAATGTGCACGAACTAATTAGCTTTCAAAAACTTAGCATATCTCAGGC
GCAATCTGAAGCAGCAGTCATATCAGAGATCAGAATGAGAAGGTTTCTTCCCCCTCTCGATAATGTACACGCATGGGCATGGCACGTTCTTCACTTCAGA
CCCTCACACACAGCTCTTTCCCCGGTAAAATCAAGGACGGCAGCAGCGCATGACTTGGCATCGCTGCCGGCTTGTGGCGCGTCCTCACAGGCTGGGCGTC
CTCTCGGCGGCGCCGGAGATGACGGTGAGCAGGTTGATGGGGATGCTGTTGCCGAAATAGCTGAGGGTGTTTCCGTCGAGGAGCAGGGCTCCGGTCTGCA
TGCATTCAGGTGACAGACACCATCCGTGAACTTTGAGTTCAAACT