Detailed information on CNT30423975


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONGMAT001703, E-value = 7e-72

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30706335Papaver somniferumPrunus avium69.3660.3683.65679forward

Expression of CNT30423975

Peptides detected in this lncRNA

>peptide 1 (37 aa)
MVSLAQRCCQEPQGELVPCTSQGWWTFQSCYLPRIQR*

>peptide 2 (35 aa)
MLSRASRRVGPLYQSRLVDLSIMLSPSNPEIGTKAI

>peptide 3 (65 aa)
MMMTWEVKLGFVVHLHRLNFSGQTGGSKSNNHTRLDDSSFNTSHWHSSNTSNLVNILKGKTKGLV*

>peptide 4 (43 aa)
MGLVGIILIIPASPFFKNLGSFSSSFPDRLSILVWISANLTAM*

>peptide 5 (94 aa)
ISADTIFIKLGKRYANKKLLTATYKPKSITSFQLTEQPKLMLPPPIKHPGLHLDAQQNKGNKRYKTAMIANQSKQETKMTTTEVNKTKPFCRPS*

Sequence

>CNT30423975
ACATTTCTGCAGACACTATTTTCATTAAACTGGGAAAGAGATACGCAAATAAAAAGTTGTTAACAGCAACTTACAAACCAAAATCCATAACAAGTTTTCA
ATTAACTGAACAGCCCAAACTCATGTTGCCACCGCCTATCAAGCACCCAGGTTTGCATCTGGATGCTCAACAAAACAAAGGCAACAAAAGATATAAAACT
GCAATGATAGCTAACCAAAGCAAACAAGAAACAAAAATGACTACTACTGAAGTAAACAAGACAAAACCCTTCTGCAGACCCTCTTAGCACCATCCCTGTA
CTTACTGGAGTACTTTACTTCTTCTTGACAGCAGACTTGGTAACCTTGGCTCCTGTTGGATCCTTCTTCTCAACTCCCTTGATGACACCAACAGCAACTG
TCTGCCTCATGTCCCTAACAGCAAAACGTCCAAGAGGTGGGTACTGAGCGAAGGTTTCTACAACCATGGGCTTGGTTGGAATCATCTTAATAATACCAGC
ATCACCGTTCTTCAAGAACTTGGGCTCCTTCTCAAGCTCCTTTCCAGATCGCCTATCTATCTTGGTTTGGATCTCAGCAAACTTAACAGCAATGTGAGAT
GTGTGACAGTCAAGAACTGGAGCATAACCATTACCGATCTGACCAGGATGGTTCATGATGATGACCTGGGAGGTGAAGTTGGGCTTCGTGGTGCATCTCC
ACAGACTTAACTTCAGTGGTCAAACCGGTGGGTCCAAAAGTAACAACCATACCAGGCTTGATGACTCCAGTTTCAACACGTCCCACTGGCACAGTTCCAA
TACCTCCAATCTTGTAAACATCCTGAAGGGGAAGACGAAGGGGCTTGTCTGATGGTCTCTTTGGCTCAGAGATGTTGTCAAGAGCCTCAAGGAGAGTTGG
TCCCTTGTACCAGTCAAGGTTGGTGGACCTTTCAATCATGTTATCTCCCTCGAATCCAGAGATAGGAACGAAGGCAATT