Detailed information on CNT30423736


BLAST search results

BLAST vs Swiss-Prot:
sp|Q41963|TIP12_ARATH, E-value = 3e-56

BLAST vs NONCODE:
NONGMAT001209, E-value = 7e-22

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30518137Papaver somniferumJuglans regia16.0120.7983.21131forward
CNT30698182Papaver somniferumQuercus lobata23.3530.5182.72191forward
CNT30375250Papaver somniferumArabidopsis thaliana18.9537.5384.52155forward
CNT30727223Papaver somniferumCorchorus capsularis22.7413.2681.72186forward
CNT30524746Papaver somniferumPhaseolus vulgaris27.7525.1180.62227forward
CNT30167253Papaver somniferumPistacia vera12.7121.489.42104forward
CNT3084637Papaver somniferumVigna radiata20.4214.5181.44167forward
CNT30239005Papaver somniferumBrassica oleracea21.1517.3282.08173forward
CNT30146734Papaver somniferumMedicago truncatula22.2529.4583.52182forward
CNT30612524Papaver somniferumArabis alpina10.5133.5987.2186forward
CNT30623609Papaver somniferumDaucus carota19.3228.1181.65158forward
CNT30643380Papaver somniferumCannabis sativa14.5525.2783.19119forward
CNT30113848Papaver somniferumFicus carica27.6329.2780.53226forward
CNT3050792Papaver somniferumCucumis sativus24.4520.0482.5200forward

Expression of CNT30423736

Peptides detected in this lncRNA

>peptide 1 (52 aa)
MDAPSKAPPAKMLAPTMKPMARGAIVPKLPFFGSMAVAYTVYTRPNVTAGLT*

>peptide 2 (41 aa)
MCVVTNETELVHEPSKSTTNQRSSPVNPVVSPCPADNCRTE*

Sequence

>CNT30423736
AAAAAATTACCAACTAAACACGATATATGAGACATGAATGAAGCACAAGATTAAATTTCAAGGGATTAAACACAAATGGCTCACATCACATACATGATCA
TCACGAAGCTTGAAACGAAAAGCGACGATTTAAAGGAAAAACACAAACCAATCCACTAAATAAATACAACAAAGACAATCCCTCTTCTTGCTCTTCATCA
TGATCCAATCATCTTAACTAGTAATCAGTGGAAGGTAATTGTTCATGTGTGTTGTGACCAATGAAACAGAACTCGTACACGAGCCCAGCAAGTCCACCAC
CAACCAAAGGTCCAGCCCAGTAAACCCAGTGGTTAGTCCATGTCCAGCTGACAACTGCAGGACCGAATGATACAGCTGGGTTCATGGATGCTCCATCGAA
AGCTCCACCGGCCAAAATGTTAGCTCCAACAATGAAACCAATGGCAAGGGGTGCAATTGTTCCCAAACTTCCCTTCTTTGGATCAATGGCTGTTGCATAT
ACAGTGTATACAAGACCGAATGTAACAGCAGGGTTAACATGACCCCCAGAGATGTTAGCACCAACAGAAACCGCAACAAATAGTGCGAAAGCATGAGCTA
ATGAGGCAGAAACAAGACCAGCAGGACTACTAGCTCCATCATTGTGAGGAATCACGGCAATGGTTACTGGCTTAACCAGTTAACCAGTCATCAATTATTA
GGTTGGGCTGCCGAATGAACTGTTGCTGTTGGTGATAACATGTAGTTGGTTGAACATAACATTCCATTACTTCAAATATTGGACGGTAGGATCTGTCAAA
GAATTTCTCTTCCAACGA