Detailed information on CNT304209


BLAST search results

BLAST vs Swiss-Prot:
sp|Q76H85|H4_SILLA, E-value = 3e-36

BLAST vs NONCODE:
NONBNAT006984, E-value = 9e-27

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30677847Zea maysSetaria viridis37.1144.1793.98216forward
CNT30317753Zea maysCorylus avellana31.2726.1584.07182forward
CNT30375418Zea maysArabidopsis thaliana10.6526.2787.162forward
CNT3042757Zea maysPrunus dulcis33.8532.5183.25197forward
CNT3082467Zea maysBrassica juncea37.1130.1382.87216forward
CNT30348363Zea maysEragrostis tef37.1138.7894.44216forward
CNT30357929Zea maysLactuca sativa33.3343.381.96194forward
CNT30645689Zea maysCannabis sativa32.340.684.57188forward
CNT3024855Zea maysPopulus trichocarpa30.7630.4980.45179forward
CNT30496126Zea maysDigitaria exilis37.9732.594.57221forward

Expression of CNT304209

Peptides detected in this lncRNA

>peptide 1 (72 aa)
MSPEMRLTPPLLASLRIAGLVMPWMLSRRTLRWRLAPPLPRPLPPLPRPDIAETERCAARTWITEEDASYWVF

>peptide 2 (58 aa)
ALCTSHTNNKREQNKIRTRHVEDENEGFPLIMASWYCRKWDTRHHRTQRRYRERTTLD*

>peptide 3 (29 aa)
PYVHLIRTINENKTKSELDTSRMKTRVFH*

Sequence

>CNT304209
GCCCTATGTACATCTCATACGAACAATAAACGAGAACAAAACAAAATCAGAACTAGACACGTCGAGGATGAAAACGAGGGTTTTCCATTGATAATGGCAA
GTTGGTATTGCAGGAAATGGGATACAAGACACCACAGAACACAGCGACGATATAGAGAACGGACTACACTAGATTAGGCACACAACACGACCACCGCCGA
CACAGATGCAGTTCGCCACCAGATGAGGAAGCGACCTAGCCGCCGAAGCCGTAGAGGGTGCGGCCCTGTCGCTTGAGCGCGTAGACGACATCCATGGCGG
TGACGGCGTCACGGATGACGTTCTCCAGAAAGATCTTGAGCACACCGCGGGTCTCCTCGTAGATGAGCCCGGAGATGCGCTTGACGCCGCCCCTCCTAGC
CAGCCTCCGGATCGCCGGCTTGGTGATGCCCTGGATGTTGTCGCGCAGGACCTTGCGGTGGCGCTTGGCGCCGCCCTTGCCCAGACCCTTGCCGCCCTTG
CCGCGCCCCGACATTGCCGAAACCGAGCGCTGCGCTGCTAGAACTTGGATCACGGAGGAAGATGCGAGTTACTGGGTTTTTG