Detailed information on CNT30419069


BLAST search results

BLAST vs Swiss-Prot:
sp|P69322|UBIQP_PEA, E-value = 0.0

BLAST vs NONCODE:
NONMEST001181, E-value = 7e-144

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT30419069

Peptides detected in this lncRNA

>peptide 1 (43 aa)
MHHEIQSQRSTLIVHKFNQPNIKPSNCKYLITVPTDDKAANIA*

>peptide 2 (39 aa)
MTAHAPRNPITKKHTNSSQIQSTKHQTKQLQIPHYSANR*

Sequence

>CNT30419069
TTTAGTTATAATCTCAATTAGGTTATGAGACAAATCAGCGATGTCTACATTTTAAGACACCCCTTATAAGTATAGGGTAAATGGCCTTATAAAACAATGG
TCCCCTCAAAGAAAAGCTGGTCCCCAAAAAATCGTTCTAGGAAAAACAGATGATTTAAGCTCAAAGTCTTTAGCACCAGCCTGGTGTCCTCAAAAAGTAG
TGTGCCTTGAAACTGGAAGGACTTCCACAGCCAGCACTTGTTTTCTTGGGCAATTGCAGGAATGACTGCCCATGCACCACGAAATCCAATCACAAAGAAG
CACACTAATAGTTCACAAATTCAATCAACCAAACATCAAACCAAGCAACTGCAAATACCTCATTACAGTGCCAACAGATGATAAAGCAGCAAACATAGCA
TAGTTTCAACAGAAGAAAGATGAGATAAGAATTTAAAAGATATTCTGCCTACTGGAGAGGACCACCACAAATGTCAACAATCTTTCAATAATCACCACCA
CGAAGACGGAGGACAAGGTGAAGAGTGGAATCCCCTCCTTGTCTTGAATCTTTGCTTTCACATTGTCAATAGTATCGGAACTCTCGACCTCCAAAGTGAT
CGTCTTCCCAGTGAGGGTCTTGACAAAAATCTGCATACCACCACGTAGACGAAGAACCAAGTGAAGTGTCGACTCCTTCTGAATATTATAATCAGCTAAG
GTTCTTCCATCTTCCAATTGCTTGCCTGCAAAAATCAATCTCTGCTGGTCTGGAGGAATGCCTTCCTTGTCCTGAATCTTGGCCTTCACATTATCAATTG
TGTCAGAACTCTCCACCTCTAAGGTTATAGTCTTTCCAGTCAAGGTCTTAACAAAAATTTGCATTCCTCCTCTGAGACGCAACACCAAGTGAAGGGTAGA
CTCCTTCTGAATATTGTAATCAGCAAGTGTACGACCATCTTCAAGTTGCTTGCCCGCAAAAATCAATCTCTGCTGGTCTGGAGGAATTCCTTCCTTGTCT
TGAATTTTTGCCTTGACATTATCGATTGTATCAGAGCTTTCAACTTCAAGGGTAATGGTCTTTCCAGTAAGGGTCTTCACAAAGATTTGCATACCACCAC
GGAGTCGAAGGACAAGATGGAGAGTAGATTCTTTCTGAATGTTGTAATCAGCAAGAGTTCTCCCATCTTCGAGTTGCTTGCCTGCGAAAATTAACCTCTG
CTGGTCTGGAGGAATTCCCTCCTTGTCTTGAATCTTGGCTTTCACATTGTCAATTGTGTCAGAGCTTTCAACTTCAAGGGTAATGGTTTTTCCAGTAAGG
GTCTTCACAAAAATCTGCATACCACCACGCAGACGAAGAACAAGGTGAAGTGTTGATTCCTTTTGAATGTTGTAGTCGGCAAGGGTACGACCATCTTCGA
GCTGTTTACCAGCAAAGATCAATCTCTGTTGATCTGGGGGAATTCCTTCCTTATCTTGGATCTTGGCTTTAACATTGTCAATGGTGTCGGAGCTTTCGAC
CTCAAGGGTAATGGTCTTACCAGTTAAAGTTTTCACAAATATTTG