Detailed information on CNT30411939


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONBNAT004661, E-value = 0.0

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT30411939

Peptides detected in this lncRNA

>peptide 1 (68 aa)
MNGAKRSAEAVGCKNASVGERSALEGSIRASRCGRSGSENVGLSNANIGENPMPRKPKGSSARFVHGG*

>peptide 2 (77 aa)
MPLEPRASWFSPKCVEAQQSTRHLGVKHCFGAGRESGTKSRQTLNTRYDPKIWGQGRPVRRWGISFIVERETARITS*

>peptide 3 (53 aa)
MGSRSASETMGDKLHRREGNSPDHQLRPLNDRSVIKEVGVQRQPGGLPRSSHP*

>peptide 4 (60 aa)
MVIGSRTQGDLRVRRGRENASSQCPSTRRYGAEVTHAILPGKARTTFNKRVPVPETDTGG*

>peptide 5 (94 aa)
KILPFSSTLGWHSLKVNGEVQTRKGLRWIPRHPETRKGVASDEMLRGVENKHRSGDSRIGQPFELLLNPWAGKRQPGELKHLSSQRKRKQKRFP*

>peptide 6 (98 aa)
MDVDKILPFSSTLGWHSLKVNGEVQTRKGLRWIPRHPETRKGVASDEMLRGVENKHISGDSRIGQPFELLLNPWAGKRQPGELKHLSSQRKRKQKRFP*

>peptide 7 (29 aa)
MGHVESRVNQQGPPCKAKYSWVTDSEVVP*

>peptide 8 (29 aa)
MGHVESRVNQQGPPCKAKYSWVTDSEVVP*

>peptide 9 (44 aa)
MPLEPRASWFSPKCVEAQQSTRHLGVKHCFGAGRXXXXRLNTPG*

>peptide 10 (30 aa)
MIAPNFSDSAVRSMIYHSWTLIRYFHLAAP*

Sequence

>CNT30411939
AAGATACTTCCATTTAGCAGCACCTTAGGATGGCATAGCCTTAAAGTTAACGGCGAGGTTCAAACGAGGAAAGGCTTACGGTGGATACCTAGGCACCCAG
AGACGAGGAAGGGCGTAGCAAGCGACGAAATGCTTCGGGGAGTTGAAAATAAGCATAGATCCGGAGATTCCCGAATAGGTCAACCTTTCGAACTGCTGCT
GAATCCATGGGCAGGCAAGAGACAACCTGGCGAACTGAAACATCTTAGTAGCCAGAGGAAAAGAAAGCAAAAGCGATTCCCGTAGTAGCGGCGAGCGAAA
TGGGAGCAGCCTAAACCGTGAAAACGGGGTTGTGGGAGAGCAATACAANNNNNNNNNNTGCTCTTTGGAGAGCACAGTACGATGAAAGTTGTAAGCTGTG
TTCGGGGGGGAGTTATTGTCTATCGTTGGCCTCTATGGTAGAATCGATCGGGGAGGCCTGAGAGGCGGTGGTTTACCCTGTGGCGGATGTCAGCGGTTCG
AGTCCGCTTATCTCCAGCTCGTGAACTTAGCGGATACAAAGGTATATGATAGCACCCAATTTTTCCGATTCGGCAGTTCGATCTATGATTTATCATTCAT
GGACGTTGATAAGATACTTCCATTTAGCAGCACCTTAGGATGGCATAGCCTTAAAGTTAACGGCGAGGTTCAAACGAGGAAAGGCTTACGGTGGATACCT
AGGCACCCAGAGACGAGGAAGGGCGTAGCAAGCGACGAAATGCTTCGGGGAGTTGAAAATAAGCATATATCCGGAGATTCCCGAATAGGTCAACCTTTCG
AACTGCTGCTGAATCCATGGGCAGGCAAGAGACAACCTGGCGAACTGAAACATCTTAGTAGCCAGAGGAAAAGAAAGCAAAAGCGATTCCCGTAGTAGCG
GCGAGCGAAATGGGAGCAGCCTAAACCGTGAAAACGGGGTTGTGGGAGAGCAATACAAGCGTCGTGCTGCTAGGCGAAGCGGTGGAGTGCTGCACCCTAG
ATGGTGAGAGTCCAGTAGCCGAAAGCATCACTAGCTTATGCTCTGACCCGAGTAGCATGGGGCACGTGGAATCCCGTGTGAATCAGCAAGGACCACCTTG
CAAGGCTAAATACTCCTGGGTGACCGATAGCGAAGTAGTACCGTGAGGGAAGGGTGAAAAGAACCCCCATCGGGGAGTGAAATAGAACATGAAACCGTAA
GCTCCCAAGCAGTGGGAGGAGCCTGGGCTCTGACCGCGTGCCNNNNNNNNNNTGGGAGAGCAATACAAGCGTCGTGCTGCTAGGCGAAGCGGTGGAGTGC
TGCACCCTAGATGGTGAGAGTCCAGTAGCCGAAAGCATCACTAGCTTATGCTCTGACCCGAGTAGCATGGGGCACGTGGAATCCCGTGTGAATCAGCAAG
GACCACCTTGCAAGGCTAAATACTCCTGGGTGACCGATAGCGAAGTAGTACCGTGAGGGAAGGGTGAAAAGAACCCCCATCGGGGAGTGAAATAGAACAT
GAAACCGTAAGCTCCCATGCAGTGGGAGGAGCCTGGGCTCTGACCGCGTGCCTGTTGAAGAATGAGCCGGCGACTCATAGGCAGTGGCTTGGTTAAGGGA
ACCCACCGGAGCCGTAGCGAAAGCGAGTCTTCATAGGGCAATTGTCACTGCTTATGGACCCGAACCTGGGTGATCTATCCATGACCAGGATGAAGCTTGG
GTGAAACTAAGTGGAGGTCCGAACCGACTGATGTTGAAGAATCAGCGGATGAGTTGTGGTTAGGGGTGAAATGCCACTCGAACCCAGAGCTAGCTGGTTC
TCCCCGAAATGCGTTGAGGCGCAGCAGTCGACTAGACATCTAGGGGTAAAGCACTGTTTCGGTGCGGGCCGCGANNNNNNNNNNAGGCTAAATACTCCTG
GGTGACCGATAGCGAAGTAGTACCGTGAGGGAAGGGTGAAAAGAACCCCCATCGGGGAGTGAAATAGAACATGAAACCGTAAGCTCCCAAGCAGTGGGAG
GAGCCTGGGCTCTGACCGCGTGCCTGTTGAAGAATGAGCCGGCGACTCATAGGCAGTGGCTTGGTTAAGGGAACCCACCGGAGCCGTAGCGAAAGCGAGT
CTTCATAGGGCAATTGTCACTGCTTATGGACCCGAACCTGGGTGATCTATCCATGACCAGGATGAAGCTTGGGTGAAACTAAGTGGAGGTCCGAACCGAG
TGATGTTGAAGAATCAGCGGATGAGTTGTGGTTAGGGGTGAAATGCCACTCGAACCCAGAGCTAGCTGGTTCTCCCCGAAATGCGTTGAGGCGCAGCAGT
CGACTAGACATCTAGGGGTAAAGCACTGTTTCGGTGCGGGCCGCGAGAGCGGTACCAAATCGAGGCAAACTCTGAATACTAGATATGACCCCAAAATATG
GGGTCAAGGTCGGCCAGTGAGACGATGGGGGATAAGCTTCATCGTCGAGAGGGAAACAGCCCGGATCACCAGCTAAGGCCCCTAAATGACCGCTCAGTGA
TAAAGGAGGTAGGGGTGCAGAGACAGCCAGGAGGTTTGCCTAGAAGCAGCCACCCTTGAAAGAGTGCGTAATAGCTCACTGATCGAGCGCTCTTGCGCCG
AAGATGAACGGGGCTAAGCGATCTGCCGAAGCTGTGGGATGTAAAAATGCATCGGTAGGGGAGCGTTCCGCCTTAGAGGGAAGCATCCGCGCGAGCAGGT
GTGGACGAAGCGGAAGCGAGAATGTCGGCTTGAGTAACGCAAACATTGGTGAGAATCCAATGCCCCGAAAACCTAAGGGTTCCTCCGCAAGGTTCGTCCA
CGGAGGGTGAGTCAGGGCCTAAGATCAGGCCGAAAGGCGTAGTCGATGGACAACAGGTGAATATTCCTGTACTACCCCTTGTTCGTCCACGGAGGGTGAG
TCAGGGCCTAAGATCAGGCCGAAAGGTGTAGTCGATGGACAACAGGTGAATATTCCTGTACTACCCCTTGTTGGTCCCGAGGGACGGAGGAGGCTAGGTT
AGCCGAAAGATGGTTATCGGTTCAAGGACGCAAGGTGACCTTAGGGTAAGAAGGGGTAGAGAAAATGCCTCGAGCCAATGTCCGAGTACCAGGCGCTACG
GCGCTGAAGTAACTCATGCCATACTCCCAGGAAAAGCTCGAACGACCTTCAACAAAAGGGTACCTGTACCCGAAACCGACACAGGTGGGTAGGTAGAGAA
TACCTAGGGGCGCGAGACAACTCTCTCTAAGGAACTCGGCAAAATAGCCCCGTAACTTCGGGAGAAGGGGTGCCTCCTCACAAAGGGGGTCGCAGTGACC
AGGCCCGGGCGACTGTTTACCAAAAACACAGGTCTCCGCAAAGTCGTAAGACCATGTATGGGGGCTGACGCCTGCCCAGTGCCGGAAGGTCA