Detailed information on CNT304044


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONZMAT001651, E-value = 0.0

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT304044

Peptides detected in this lncRNA

>peptide 1 (54 aa)
MYEKWIAGKEKSALRKIGGKLPSFSWSSQGLTTTERCTCTRKGNYNYHGKDLTI*

>peptide 2 (37 aa)
SNVVCTRNLELRVTMAWLSWSLSPLKALSGKYGCLSQ*

Sequence

>CNT304044
CTCCAATGTTGTCTGCACTAGAAACCTAGAGCTAAGAGTGACAATGGCATGGCTCTCTTGGTCCCTCTCTCCCTTGAAGGCTCTCTCTGGTAAATATGGT
TGCCTTTCACAATGAACTTCCATCAGATCTTTGTGAGAGAGCCTTCAGGAGGGGGGGGGGATCCAGGTGAGCCATAGTGCCTGACTGCCTGTGCCCAGCA
GCCAAGATGTGTACTGTTTAGCCATTTTGTGTATTTGATTAATTGTTTGTTTCTATGAGAACTTGGTTAATCATGTGTTGTATTGATTGTTCACAAATGA
AATTAGCTTTTCTCAATCAGCATCGGTCACCGGATGTATGAGAAATGGATAGCGGGTAAGGAAAAGAGCGCTCTAAGGAAAATAGGGGGTAAGTTGCCAA
GTTTTTCTTGGAGCTCTCAGGGTCTCACCACAACTGAGAGGTGCACGTGCACAAGAAAAGGTAACTATAATTATCACGGTAAAGATCTAACAATTTGAAT
AGGCTTTATTAGCATTAAGCACAAGAAATTCCTTAAAAGAACATCTTGCATGACTGACCTGGCATAATACCAGCAACCAAATTGTTCTTTTGTAGGAGCT
GGATGAGTTTTCTGGGTCTTGGATTACAGAAATGGATGAGATGTTCTCCTTGTCTTGGGCTTCAAACCATTCCTAAGTAAAAATATTT