Detailed information on CNT3039195


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30230656Cucumis meloAnanas comosus6.3538.6786.2187forward

Expression of CNT3039195

Peptides detected in this lncRNA

>peptide 1 (39 aa)
MKQITDSRYKSRYKWTSEENFLLASFLFFSYFQCNGSVV*

Sequence

>CNT3039195
GCCTTAAACTAATGAGTAAGGAAAACAAAGTGGCCGGGGGGATCCGGCCGCAGCGCTAACCAAAGTGATGCGCATGAATTTGTGGAGGGGTTAAAGGCTT
GGCCGATTGTTGACGCTGCTTACTTTGCAGAACTCTTTCGTGCTGGCCTCCCAATTTACCCACCCCCAATTCCAGTCAAAAGCCCTTTCTCCCTATTGGT
TATATTATTATTATAGTATTATGTATCTTGTAGATGCAATAACAGTTGTTAAATTTTATTTCTGATTTGTCGAAAAGAACCAACCTTCTATCTAATTTTT
GGTTAAAAGTCGTAGTTCGAGTTTCCATTTCGGTTTCTCTACCTATGTAGGGAAACTGATCCATAACTTAATTCAGGGGTGCTTTGGAACCATTCTGGGC
GTTACTCTCTATTAGGCGATTGCTCACTACCTCTCAATTTAGTTCCACTTTAAGGGGGGATTATTGCTAATGCTTTGTTCACTGCTGCACAACTTTTAAC
TCACCTTAGAGGTTTTGATATATTATTATTTCGCATCGGTTAGATCTCTTGTAAATCAGAAGAATTTGAGGTGTTGTTTACTTCAGAACAAGAATTTCTT
ACTGTTAAAAGGGAGGTTCAAGTTTCTTAAGACCAGCTAAGCTAAGCTAGTAGCTGAAATTCTAGTTGTATAAGCTAAAGAAAAGAATCAAAGATGAACG
ATGAAACAAATCACAGATTCCAGATATAAATCCAGATATAAATGGACAAGCGAAGAAAACTTTCTTCTTGCTAGTTTCTTATTTTTCTCCTATTTTCAAT
GCAATGGTAGTGTGGTTTAAGTTTGGAAGAAAACTAAGAAGGGAATGACTTGGGAATCACAGTGCTAAATGTTGGAAGGCGATTTTATCCGGCTGTGAAT
TTTTGGTGTTGCGAGTTTCTTGGAGTCGTATCAAATTTGCAGGGCAAGTTGAATCTTCACTTCACTTCACTTCATAGTTAAATTTAGAGTAAAATCTTCA
ACTTTTCTTCTAATGGCATTTCAATCACAATAGAGAAATTTCATAATTCTGTTTTTATTCTTTAGAGGTCGAAATTCCTAATGCTGTTGAACTAAAAAAG
TATAGTTTTGACTAACGATAATATATTGTTTATGTGCAATATTGATTCGAAACATAATATATTTTTAATGTTTATGTTCAATATTTGATTTAATTATCAT
GTAGGATATTCATTTTATTTTTTATTTTGAAATTAAGTCAAATTGCCTCCGACTTTCTTTCCTTATTATTTACATTTCAATAATGATTTAATTTCGGTAA
AATCTAAAAACAAAAAAGTAGCTTTTAAAATAGAAAATAATTGTAAATAACATAAGTGCTAAAAATGTTTT