Detailed information on CNT3038844


BLAST search results

BLAST vs Swiss-Prot:
sp|Q7X9A0|RCA1_LARTR, E-value = 7e-122

BLAST vs NONCODE:
NONBRAT002426, E-value = 6e-50

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30517378Cucumis meloJuglans regia30.9220.9885.14222forward
CNT30373758Cucumis meloArabidopsis thaliana24.6547.0787.01177forward
CNT30282863Cucumis meloChenopodium quinoa27.4410.2986.29197forward
CNT30727557Cucumis meloCorchorus capsularis25.3543.6588.46182forward
CNT30628493Cucumis meloVigna unguiculata27.0224.2585.05194forward
CNT30712287Cucumis meloGlycine max24.3711.3987.43175forward
CNT3096945Cucumis meloSolanum tuberosum11.4230.0489.0282forward
CNT30185579Cucumis meloSecale cereale43.7382.282.8314forward
CNT30295371Cucumis meloTriticum aestivum28.8352.0186.96207forward
CNT30223071Cucumis meloHordeum vulgare28.8327.7588.41207forward
CNT30564971Cucumis meloActinidia chinensis16.1640.2887.07116forward
CNT30171766Cucumis meloTrifolium pratense21.4518.488.31154forward
CNT30144634Cucumis meloMedicago truncatula24.3744.4288.57175forward
CNT30439608Cucumis meloAegilops tauschii28.8317.2586.96207forward
CNT30663145Cucumis meloTriticum dicoccoides28.8344.0486.96207forward
CNT3074780Cucumis meloBrassica juncea11.725.9390.4884forward
CNT30260820Cucumis meloBrassica rapa25.9116.488.71186forward
CNT30136831Cucumis meloLolium perenne16.322.6782.91117forward
CNT306857Cucumis meloZea mays28.139.4985.15202forward
CNT30609928Cucumis meloGossypium raimondii28.8345.4986.96207forward
CNT30233037Cucumis meloAnanas comosus26.8863.9183.42193forward
CNT30218871Cucumis meloKalanchoe fedtschenkoi20.8934.4884.67150forward
CNT30213184Cucumis meloHelianthus annuus30.921288.29222forward
CNT30683693Cucumis meloTriticum urartu24.9322.9586.59179forward
CNT30360399Cucumis meloLactuca sativa20.8921.992150forward
CNT30371341Cucumis meloOryza glumipatula15.0446.3584.26108forward
CNT30642662Cucumis meloCannabis sativa26.8837.6289.64193forward
CNT3034456Cucumis meloTheobroma cacao20.3367.9186.99146forward
CNT3024431Cucumis meloPopulus trichocarpa19.529.1785140forward
CNT30120246Cucumis meloCitrus clementina27.165088.21195forward
CNT30150829Cucumis meloBrachypodium distachyon15.0422.8885.19108forward
CNT30604727Cucumis meloOryza punctata36.6398.582.13263forward
CNT3039667Cucumis meloMarchantia polymorpha6.6921.2491.6748forward

Expression of CNT3038844

Peptides detected in this lncRNA

>peptide 1 (59 aa)
MIGTRGFSSLLYIPGSWTLVGLSAMQDIFPFLIMSAASRYRCRINLAGSPAFPLSNSPAL

Sequence

>CNT3038844
GAGAGCACTCATTTCCTTTCCCCACAGAGACACAAACTTGATGATGAGTGTCATGAAATGAGTTGGACACCAACACACAAGCTTTAATTTAGAAAGCTCC
TCTAGTAATGGCATCTTCATTGGCATTGCCAAGAGCAGCCTCATTCAAATAAGTTTCAGCCAATTGCACCCTCTTCACGTTCTCTTGTTCTTGAACCAAC
ATGCTACCATACTCCAACAGCTTTTGAAGTGTCATTGCTGGCTGCTCGAACTTCGGTGGTGGCTCTTTTGAGTTCACAAGCTTCTTCCCAATAGCCTGGA
CTCCAACTGCGACGACCCACTTCCTTACTTCGTCATCGTACACTCTCGCCCTTAGAGCACCGAAGAAATCTGTGTCGACCAACTTGACGATGTCCTCATC
AGCCACATTGTCGGTACGGAAGATACCTTTGCAGACACCGATACGGTCTTCCCTAGTGGGTGCCCAGTAGAATTTCTCCATACGACCGTCACGGATGAGA
GGAGCGTAGAGAGTGGAGAAATCGTTACCAGTGACGATGATTGGAACTCGGGGGTTCTCCTCCTTGTTGTACATTCCAGGGAGTTGGACATTGGTGGGGT
TATCGGCGATGCAGGACATTTTTCCCTTCTTGATTATGTCAGCCGCCTCACGGTACCGTTGTCGGATCAACTTGGCTGGCTCTCCTGCGTTCCCGCTTTC
CAATTCTCCGGCACTCAT