Detailed information on CNT3038779


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30562839Cucumis meloActinidia chinensis32.3819.8780.8125forward
CNT30360641Cucumis meloLactuca sativa20.2115.5787.1878forward

Expression of CNT3038779

Peptides detected in this lncRNA

>peptide 1 (35 aa)
MRRISHNESTHFLSPQRHKLDDECHEMSWTPTHKL*

Sequence

>CNT3038779
TGGTTCCACAAAAGAAAGAAGAAGAAAGAACAAAAAGGCCTGAAGAATATATAGATGAGACGAATCTCACATAATGAGAGCACTCATTTCCTTTCCCCAC
AGAGACACAAACTTGATGATGAGTGTCATGAAATGAGTTGGACACCAACACACAAGCTTTAATTTAGAAAGCTCCTCTAGTAATGGCATCTTCATTGGCA
TTGCCAAGAGCAGCCTCATTCAAATAAGTTTCAGCCAATTGCACCCTCTTCACGTTCTCTTGTTCTTGAACCAACATGCTACCATACTCCAACAGCTTTT
GAAGTGTCATTGCTGGCTGCTCGAACTTCGGTGGTCACCACTTTCTTCCCGAAGAACACTGAACTCGGAACCGAAGTAGCGGATCC