Detailed information on CNT30382289


BLAST search results

BLAST vs Swiss-Prot:
sp|Q8GZC3|FAD2_VERFO, E-value = 2e-135

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30375610Manihot esculentaArabidopsis thaliana32.3430.1179.34271forward
CNT30617145Manihot esculentaSesamum indicum10.3829.4990.887forward
CNT30712523Manihot esculentaGlycine max22.3233.4583.96187forward
CNT30509059Manihot esculentaSolanum lycopersicum17.6629.3783.11148forward
CNT30146728Manihot esculentaMedicago truncatula17.7834.6588.59149forward
CNT30314096Manihot esculentaCamelina sativa23.1539.4380.93194forward
CNT3075396Manihot esculentaBrassica juncea2138.678.98176forward
CNT30650498Manihot esculentaRosa chinensis26.9740.0782.74226forward
CNT30717160Manihot esculentaMalus domestica golden14.0833.6284.75118forward
CNT30626192Manihot esculentaDaucus carota22.4337.4579.79188forward
CNT30620011Manihot esculentaCajanus cajan22.327.4481.28187forward
CNT30154726Manihot esculentaPrunus persica27.4532.7682.61230forward
CNT30705704Manihot esculentaPrunus avium27.4511.3582.17230forward
CNT3031674Manihot esculentaTheobroma cacao13.1330.7382.73110forward
CNT30323777Manihot esculentaAsparagus officinalis13.7231.1782.61115forward
CNT30120535Manihot esculentaCitrus clementina19.5737.781.1164forward

Expression of CNT30382289

Peptides detected in this lncRNA

>peptide 1 (43 aa)
MVRYMSICYIMKHLVQDTIISIDVCWRYVIVTRNAFTTNKGTP*

>peptide 2 (32 aa)
MHSPPTKELHKHRLPKQAPSLQQYGRDHRRLQ*

>peptide 3 (75 aa)
MLEICDRNKKCIHHQQRNSINTDYPSKPLRCSNTEETIGDCNNTSIRYEYLSPLTVSVDRSIWVIVAGKAIIMPA*

>peptide 4 (44 aa)
MVPTLVCYNPNTSEDTSLDAPVNWPGHIGERMREELEVVGGDVI*

>peptide 5 (34 aa)
PHCLIERSPIKLVVFAQNWFNGLCCLHCIIMWHF*

Sequence

>CNT30382289
CCACATTGCCTTATAGAAAGGAGTCCCATCAAATTGGTAGTATTCGCCCAAAATTGGTTTAATGGCCTTTGTTGCCTCCATTGCATAATAATGTGGCATT
TTTGAGAAGAGATGGTGCGCTACATGAGTATCTGTTATATTATGAAACACCTTGTTCAAGATACCATAATCTCTATCGACGTATGCTGGAGATATGTGAT
CGTAACAAGAAATGCATTCACCACCAACAAAGGAACTCCATAAACACAGACTACCCAAGCAAGCCCCTTCGCTGCAGCAATACGGAAGAGACCATAGGCG
ACTGCAATAACACCAGCATCAGATATGAATATCTCAGCCCTCTCACGGTCAGTGTAGATAGGTCCATATGGGTCATAGTGGCAGGCAAAGCGATCATAAT
GCCTGCCTGAGACATTGAATAATAGGTACAGAGGCCAGCCAAGGGTAAGAGTAATAATAAGTGTAAGGAGACGGCCTAGTGGGTTGTTAAGGTATCTGGC
GAACCAACGGGTGTTAGATTTTTTCTTGGGGACAAATACTTCATCTTCCTCAAGGGAGGCTGTGTTGGAGTGATGACGGCGGTGGCTATGTTTCCATGAA
AAGTAAGGAACCAGCAGGCAGGAGTGGAGAATAAGGCCAACTGTATCATCAAGCCATTGATAGTCACTGAAGGCATGGTGCCCACACTCGTGTGCTATAA
CCCAAACACCAGTGAGGACACATCCCTGGATGCACCAGTAAATTGGCCAGGCCACATAGGAGAGAGGATGAGGGAGGAGTTGGAAGTAGTTGGTGGCGAT
GTAATATAAAATAAAGGCAACGGTTAGGTCTACAATAA