Detailed information on CNT30381982


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONMEST002111, E-value = 1e-130

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30524746Manihot esculentaPhaseolus vulgaris31.1917.1580.65155forward
CNT30628528Manihot esculentaVigna unguiculata22.9412.8585.96114forward
CNT30712512Manihot esculentaGlycine max18.1123.3886.6790forward
CNT3084586Manihot esculentaVigna radiata22.948.0183.33114forward
CNT30619970Manihot esculentaCajanus cajan23.7430.7383.9118forward
CNT30176366Manihot esculentaVigna angularis22.9423.884.21114forward

Expression of CNT30381982

Peptides detected in this lncRNA

>peptide 1 (38 aa)
GKFGIEMEKNKCKMTRNGIIQPEQNTQITPLELDDCDG*

Sequence

>CNT30381982
CGGGAAATTTGGAATTGAGATGGAAAAAAATAAATGCAAGATGACTAGAAACGGAATCATACAACCGGAGCAGAATACACAAATCACACCCTTGGAATTG
GATGATTGCGATGGATAAAAAGATCAACGATCACAATTTAAACACGGGATAAATAATTACCCTCCAATGGTAAAAATAAATACACCAGAAATAAAAAGAA
AAAGCCGAGCCAACCGATCATCCATGCACCACCACCATTCACCGCTGGTTTAGTAGTCGGTGGTGGGAAGCTGCTCGTGGGTGTTGGATGCAGCAACAAG
ACCGGCAGGGGTGTTTGCAGCGTTGTCGGTTAGCTTGCTAAAGGCCATACCAGAACCTTCTCCGGCGAAAACGAAAATAAGAGTGGAGATGAACTCAGCC
AAAGCCGCCTTCAAGGCGTCTGGATGAGTTGCCTCCTGAGGATGGCCAACGGCGATGTTTCTGATCGGCATCTTCCACTTGTAATAATGAAGCTCCG