Detailed information on CNT30381906


BLAST search results

BLAST vs Swiss-Prot:
sp|P0CH05|UBI2P_PETCR, E-value = 0.0

BLAST vs NONCODE:
NONMEST001181, E-value = 2e-103

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT3043617Manihot esculentaPrunus dulcis68.5289.8581.98788forward
CNT30359535Manihot esculentaLactuca sativa78.4353.482.26902forward
CNT30154607Manihot esculentaPrunus persica79.371.3682.13912forward
CNT3031445Manihot esculentaTheobroma cacao79.2284.0482.99911forward
CNT30120672Manihot esculentaCitrus clementina80.1750.5882.43922forward

Expression of CNT30381906

Peptides detected in this lncRNA

>peptide 1 (34 aa)
MVLPVRVLTKICILETDQRKRKGFPVAVEEDRVSI

>peptide 2 (34 aa)
LLIINGLYLLIELIRHIILQYYLILLGKQESSEI*

>peptide 3 (71 aa)
MKSRLLLDVIVSQGTAVFKLLAGEDQPLLVGGNSLLILNLGLDIIDCIGALDLESYGLACEGLDEDLHIGD*

>peptide 4 (52 aa)
AYNKRTLFINRTHTTYHTTILLNIIRKAGKFRNLIRNARNQTPRHTDQSSKL*

>peptide 5 (46 aa)
MLETKHPDTQIKAANFNSAIATAKTEHKVESGLLLDVIIREGPPIL*

Sequence

>CNT30381906
TTGCTTATAATAAACGGACTTTATTTATTAATAGAACTCATACGACATATCATACTACAATACTACTTAATATTATTAGGAAAGCAGGAAAGTTCAGAAA
TTTGATACGAAATGCTAGAAACCAAACACCCAGACACACAGATCAAAGCAGCAAACTTTAATTCAGCAATCGCCACCGCGAAGACGGAGCACAAGGTGGA
GAGTGGACTCCTTCTGGATGTTATAATCCGCGAGGGTCCTCCCATCCTCTAGCTGCTTTCCTGCAAAGATAAGCCTTTGCTGATCCGGTGGAATTCCTTC
CTTGTCTTGGATTTTTGCCTTCACATTGTCAATTGTATCAGAACTCTCAACCTCCAGAGTGATAGTCTTCCCAGTCAAGGTCTTCACAAATATCTGCATA
CCCCCACGAAGCCTCAGAACCAGATGAAGGGTTGACTCCTTTTGGATGTTATAATCAGCGAGGGTCCTTCCATCCTCCAGCTGCTTCCCAGCAAAGATCA
ATCGTTGTTGATCTGGTGGGATACCTTCCTTATCTTGAATCTTGGCTTTGACGTTATCGATTGTATCCGAGCTTTCGACTTCCAGGGTTATCGTCTTTCC
GGTGAGGGTTTTTACAAAGATCTGCATTCCTCCCCTCAATCGGAGAACGAGATGCAAGGTGGATTCCTTCTGTATGTTATAATCTGCTAGCGTCCTTCCA
TCCTCCAATTGCTTTCCGGCAAAGATCAGCCTCTGCTGGTCAGGAGGAATCCCTTCCTTATCTTGGATCTTGGCCTTAACGTTGTCAATTGTGTCAGAGC
TCTCGACCTCAAGAGTTATGGTCTTGCCGGTGAGAGTCTTAACAAAGATCTGCATGCCACCCCGAAGACGGAGGACAAGATGAAGAGTAGACTCCTTCTG
GATGTTATAGTCAGCCAGGGTACGGCCGTCTTCAAGCTGCTTGCCGGCGAAGATCAACCTCTGTTGGTCGGGGGGAATTCCCTCCTTATCTTGAATCTTG
GCCTTGACATTATCGATTGTATCGGAGCTCTCGACCTCGAGAGTTATGGTCTTGCCTGTGAGGGTCTTGACGAAGATCTGCATATTGGAGACTGATCAAC
GGAAAAGAAAAGGCTTTCCGGTAGCTGTTGAAGAAGATAGGGTTTCGATT