Detailed information on CNT30381695


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT30381695

Peptides detected in this lncRNA

>peptide 1 (32 aa)
DFCVHVTWGSLLSLSLYVCVCVCIYIYVHSTF*

>peptide 2 (46 aa)
MGLAMKFQKKNKETKGRDGMTPLALKAKRKIYNMNSYLSTTVLSRL*

>peptide 3 (45 aa)
IFVCMSLGGPFSLSLSMCVCVCVYIYMFTVHFNCIIKILGIHSAN*

>peptide 4 (65 aa)
MASSRARTPGSSLPSNNSKLAPPPVDMWLITSATPTFSTAATESPPPIIVVTPLPLSCASFFAIA*

>peptide 5 (63 aa)
MQGWGKNQTNLTQQLVWLHQEQGHLEALCLPTTPNWHHHRLICGSLHQQLLLFLQLQQNLHLR*

Sequence

>CNT30381695
TGATTTTTGTGTGCATGTCACTTGGGGGTCCCTTCTCTCTCTCTCTCTCTATGTGTGTGTGTGTGTGTGTATATATATATATGTTCACAGTACATTTTAA
CTGCATAATTAAAATTTTGGGCATACATTCTGCTAACTGAAATTGCTTCAAGCATGGGACTTGCAATGAAATTTCAGAAAAAGAATAAAGAAACAAAAGG
GAGAGATGGAATGACACCTCTGGCATTGAAGGCAAAGAGAAAAATTTACAACATGAACTCATATCTCTCCACAACAGTTCTTTCTCGTTTATGAAGAACA
ATAAAGAGCACTAAATGCAGGGATGGGGAAAAAATCAGACTAATCTTACACAGCAACTGGTATGGCTTCATCAAGAGCAAGGACACCTGGAAGCTCTTTG
CCTTCCAACAACTCCAAACTGGCACCACCACCGGTTGATATGTGGCTCATTACATCAGCAACTCCTACTTTTTCTACAGCTGCAACAGAATCTCCACCTC
CGATAATTGTTGTGACACCCTTGCCACTAAGCTGCGCTAGCTTCTTTGCAATAGCCTGAAACCAGAGGTGCAAATATTCATCAGAAAATTCAGCCGTCAG
GTCTCCCACGCTCTTCTTCGCCATGAGGACCACTGCCCTCGAGGCCTTACCGGAACCAAAAGATTGAATTTTGGATGCAACATGACGAGTTAAAATAGGG
TCAGCAGCAGCGAAGCCAAGGCGGCGAAGACTGGTGGAGCGGAGGCCAGCGGAGGAAACTGGAAGAAGAGAAGGGCGGGCGCGGGTGGAGGAGGATGAGG
AAGAAGATGTGGTTTTGAGAAGGGAAAGGGTTGTGGGAGCTGCAGCAGAGGCCATTATTAGTGGGTTGCTCCGTTGTTTTAG