Detailed information on CNT30379936


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONGMAT000778, E-value = 2e-48

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30674834Manihot esculentaSetaria viridis44.9123.489.33150forward
CNT30532843Manihot esculentaEucalyptus grandis41.6218.9987.05139forward
CNT30316236Manihot esculentaCorylus avellana52.137.9187.93174forward
CNT30547574Manihot esculentaIpomoea triloba55.6952.3988.71186forward
CNT30512729Manihot esculentaJuglans regia75.7524.5986.96253forward
CNT30372986Manihot esculentaArabidopsis thaliana54.1917.7185.08181forward
CNT30276060Manihot esculentaChenopodium quinoa53.2928.0887.64178forward
CNT30405823Manihot esculentaBeta vulgaris33.8325.1187.61113forward
CNT30488117Manihot esculentaOlea europaea56.2938.5284.57188forward
CNT30711584Manihot esculentaGlycine max77.5436.7985.71259forward
CNT3045373Manihot esculentaPrunus dulcis44.3118.8890.54148forward
CNT30191304Manihot esculentaSecale cereale75.4519.3785.71252forward
CNT30300473Manihot esculentaTriticum aestivum75.4526.0386.9252forward
CNT30224354Manihot esculentaHordeum vulgare70.3645.2886.38235forward
CNT30395070Manihot esculentaTriticum turgidum73.9532.2985.43247forward
CNT30561656Manihot esculentaActinidia chinensis71.261786.55238forward
CNT30510505Manihot esculentaSolanum lycopersicum73.9522.7487.45247forward
CNT30552635Manihot esculentaOryza glaberrima75.4524.2885.71252forward
CNT30440797Manihot esculentaAegilops tauschii75.4534.6287.3252forward
CNT30313757Manihot esculentaCamelina sativa60.4823.0384.65202forward
CNT3059659Manihot esculentaArabidopsis lyrata46.7135.9483.33156forward
CNT30612508Manihot esculentaArabis alpina55.097.2584.24184forward
CNT30135610Manihot esculentaLolium perenne63.1724.9486.26211forward
CNT3014085Manihot esculentaZea mays68.5637.5486.46229forward
CNT30605685Manihot esculentaGossypium raimondii73.9532.3387.04247forward
CNT30684236Manihot esculentaTriticum urartu73.0529.6886.07244forward
CNT30345702Manihot esculentaEragrostis tef27.2511.2687.9191forward
CNT30596122Manihot esculentaOryza meridionalis56.2927.1787.77188forward
CNT30359537Manihot esculentaLactuca sativa37.4318.9785.6125forward
CNT30370118Manihot esculentaOryza glumipatula62.5733.8288.04209forward
CNT30107537Manihot esculentaOryza longistaminata75.4527.4284.92252forward
CNT30100253Manihot esculentaOryza rufipogon75.4522.8785.71252forward
CNT30575986Manihot esculentaOryza barthii64.9718.3788.02217forward
CNT30497701Manihot esculentaDigitaria exilis73.957686.64247forward
CNT30116094Manihot esculentaOryza nivara75.4528.6485.71252forward
CNT30604019Manihot esculentaOryza punctata62.5761.8388.52209forward

Expression of CNT30379936

Peptides detected in this lncRNA

>peptide 1 (91 aa)
MPLMFSSASAPSFEAHWNPATTESLISLRYCTPLHISTTMLGPVVSGPKHQIFLARSLSQPNSSDNILARALPPCRDDCACWGTCSSQPDKI

>peptide 2 (31 aa)
TTSVNSISMKNHITYFKANAPHVFFSQCTFF*

Sequence

>CNT30379936
CACCACCTCTGTGAATAGCATCAGCATGAAGAACCACATCACATACTTCAAAGCAAATGCCCCTCATGTTTTCTTCAGCCAGTGCACCTTCTTTTGAAGC
CCACTGGAACCCAGCTACGACCGAGTCCTTGATTTCATTAAGGTACTGCACTCCCTTGCACATATCAACAACCATGTTAGGTCCAGTAGTCTCAGGACCA
AAACACCAAATCTTCTTAGCCAGATCCTTATCCCAACCAAATTCCTCGGACAATATCTTAGCTCGTGCCTTGCCTCCATGTAGAGACGATTGTGCTTGTT
GGGGGACTTGCTCATCACAACCCGACAAGATTTC