Detailed information on CNT30379431


BLAST search results

BLAST vs Swiss-Prot:
sp|P69309|UBIQP_AVEFA, E-value = 7e-157

BLAST vs NONCODE:
NONMEST001181, E-value = 0.0

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30652074Manihot esculentaRosa chinensis71.7198.784.46682forward
CNT30625885Manihot esculentaDaucus carota70.0384.6384.83666forward

Expression of CNT30379431

Peptides detected in this lncRNA

>peptide 1 (30 aa)
KKETEVRYIPENMKQETGCYLGKLSQLYCH*

>peptide 2 (36 aa)
QERNRSQIHPRKHETRNRMLFRQTKPTLLPLKEKEY*

>peptide 3 (53 aa)
MPSLSWILAFTLSIVSELSTSKVMVFPVRVFTKICMPPRRRSTKWRVDSFWIL*

Sequence

>CNT30379431
GCAAGAAAGAAACAGAAGTCAGATACATCCCAGAAAACATGAAACAAGAAACAGGATGTTATTTAGGCAAACTAAGCCAACTTTATTGCCATTAAAGGAA
AAAGAGTACTAATGACCTTATACTGGCCATCTTTAACAGGCTTTAGACAAGTACTTATAACCATTCCAACATAACCAAGTATTTAGGACTTACTACTTAT
TTAAAAGCCATTAAGGCATTACCAGTAGCTAGTAAAAACAAACTAGGACACAACCACACAACTCAGATACCACCACGAAGGCGAAGGACAAGGTGCAAGG
TAGACTCCTTCTGGATATTGTAATCAGCAAGTGTCCTCCCATCCTCGAGCTGTTTTCCAGCAAATATCAATCTCTGCTGATCTGGTGGGATGCCTTCCTT
GTCCTGGATTTTAGCCTTCACATTGTCAATAGTATCTGAACTCTCTACCTCCAAGGTAATGGTCTTCCCGGTAAGGGTCTTCACAAAGATCTGCATGCCT
CCACGAAGGCGAAGCACCAAGTGGAGGGTGGACTCCTTCTGGATATTGTAGTCTGCAAGTGTACGGCCATCCTCCAGCTGCTTACCGGCAAAGATCAACC
TCTGCTGGTCTGGTGGGATCCCCTCCTTATCCTGAATCTTGGCCTTGACATTATCAATAGTATCAGAGCTTTCCACTTCCAAAGTAATTGTCTTGCCAGT
GAGGGTTTTCACAAAGATTTGCATGCCTCCACGAAGGCGGAGCACCAAATGAAGGGTGGACTCCTTTTGAATATTGTAGTCAGCAAGGGTGCGGCCATCC
TCTAGCTGCTTACCAGCAAAGATCAGCCTCTGCTGGTCTGGTGGAATACCTTCTTTGTCCTGGATCTTAGCCTTTACATTGTCAATGGTGTCTGAACTTT
CCACCTCCAAAGTGATTGTCTTGCCGGTGAGAGTTTTTACAAAGATCTGCA