Detailed information on CNT30378968


BLAST search results

BLAST vs Swiss-Prot:
sp|O81825|DRL28_ARATH, E-value = 2e-27

BLAST vs NONCODE:
NONMEST000066, E-value = 0.0

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT30378968

Peptides detected in this lncRNA

>peptide 1 (51 aa)
HSTKLLLMYSSSSSDSFDKAFAGIILSLEQLLTSKTFSRASCSICLGNSTT*

>peptide 2 (31 aa)
MDPSKIHYFQVSNALEKLMWDSQRKNFGKKE*

>peptide 3 (29 aa)
MLLSRCNQESSISNNIMDFYESIHVAILQ*

>peptide 4 (29 aa)
MQSREQYLEQHHGFLRIHTRRHLAISSAL*

Sequence

>CNT30378968
CACTCAACAAAACTGTTACTCATGTATAGTTCTTCAAGCTCCGACAGCTTTGATAAGGCATTTGCTGGAATCATTTTGAGTTTGGAACAATTGCTCACAT
CTAAGACTTTTAGTCGAGCCAGTTGCTCTATTTGTCTGGGCAACTCAACAACGTAGGAGTTTGCAAAACTAAGAACTCGTAGTTGCTTCAAGTCTCCAAT
GATAGCTAAGTCCTCCAGTTGGCACCGATGCAAGCAAAGGGTATGAAGGTTGGATAGGAAAGCGAGCGATGAAGGGAGGGACACAAAATGGATCCCAGTA
AAATCCACTACTTCCAGGTTTCTAATGCCCTTGAAAAACTGATGTGGGATTCCCAAAGAAAAAATTTCGGTAAAAAGGAGTAGTGCCTCTGCTTTTGGGC
ACTCCCATCCTTCGGGGAGATTTTCAATATCACAATACGGCAGAGAAATTCTGGTGCAATCCTTATTTGGGAATTTCATCAACTCCCTGCCACTTGTAAC
TATAAACGCATGTTGCTCTCTAGATGCAATCAAGAGAGCAGTATCTCGAACAACATCATGGATTTTTACGAATCCATACACGTCGCCATCTTGCAATAAG
CTCTGCGCTTTAAGGGTATCAATCA