Detailed information on CNT30378644


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONMTRT001211, E-value = 4e-33

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30617295Arabidopsis thalianaSesamum indicum59.0140.7384.43167forward
CNT30196749Arabidopsis thalianaPisum sativum83.7558.8183.97237forward
CNT30168132Arabidopsis thalianaPistacia vera68.947.4583.59195forward
CNT30441907Arabidopsis thalianaAegilops tauschii71.3879.2284.65202forward
CNT3078381Arabidopsis thalianaBrassica juncea87.6392.8891.13248forward
CNT30614348Arabidopsis thalianaArabis alpina59.0115.8391.62167forward
CNT30204946Arabidopsis thalianaHelianthus annuus42.7632.2790.91121forward
CNT30623465Arabidopsis thalianaDaucus carota88.3489.2980.4250forward
CNT30721041Arabidopsis thalianaTriticum spelta35.6949.0385.15101forward
CNT30364046Arabidopsis thalianaSorghum bicolor80.213985.02227forward
CNT3054454Arabidopsis thalianaAmborella trichopoda39.582085.71112forward
CNT30116105Arabidopsis thalianaOryza nivara72.7927.9180.1206forward

Expression of CNT30378644

Peptides detected in this lncRNA

>peptide 1 (32 aa)
GSEFESPEANIVQGLVIKNHALISILNKLMNR*

>peptide 2 (29 aa)
GVVSLRVLKQISYKASLSRTMHSSAFSTS*

Sequence

>CNT30378644
GGGGTAGTGAGTTTGAGAGTCCTGAAGCAAATATCGTACAAGGCCTCGTTATCAAGAACCATGCACTCATCAGCATTCTCAACAAGCTGATGAACAGATA
AAGTAGCGTTGTAAGGCTCCACCACAGTATCAGAAACCTTTGGTGAAGGGAACACCGAGAAGGTAAGCATCATGCGATCTGGGTACTCTTCACGGATCTT
AGAGATCAACAATGTTCCCATACCAGATCCAGTTCCTCCTCCCAACGAGTGACAAACCTGGAACCCTACACAAGGAAATCTCA