Detailed information on CNT30378008


BLAST search results

BLAST vs Swiss-Prot:
sp|P29402|CALX1_ARATH, E-value = 0.0

BLAST vs NONCODE:
NONATHT003963, E-value = 0.0

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30676366Arabidopsis thalianaSetaria viridis11.727.1189.62106forward
CNT30190468Arabidopsis thalianaSecale cereale39.2936.8182.58356forward
CNT30397803Arabidopsis thalianaTriticum turgidum39.0745.181.92354forward
CNT30238817Arabidopsis thalianaBrassica oleracea41.8371.1192.61379forward
CNT30144554Arabidopsis thalianaMedicago truncatula39.8542.1780.06361forward
CNT30349705Arabidopsis thalianaEragrostis tef35.9846.580.06326forward

Expression of CNT30378008

Peptides detected in this lncRNA

>peptide 1 (52 aa)
ASKWSVCKSQRPSRLSLSRCCQTRYHLALSRSQYRWLQWVRNRVCLAQSSQG*

>peptide 2 (94 aa)
MGKLVIRNRGRELQMVFNVLATLGILVLQDEMHFVRTSTLVRPKHDRVRGFTIESLRCPSSFLRTEVLQVSTTTLKSFLETNLVLKNNSSFLEV*

>peptide 3 (40 aa)
MVLAGINAGSKSSPESKLAFFFSSPSTKILTSLSGFKMAV*

>peptide 4 (46 aa)
GLPSGLSVSLSDLLVFRYQDVVKQDTILHCPDLNTDGCNGFVIGSV*

Sequence

>CNT30378008
GGGCTTCCAAGTGGTCTGTCTGTAAGTCTCAGCGACCTTCTCGTCTTTCGCTATCAAGATGTTGTCAAACAAGATACCATCTTGCATTGTCCAGATCTCA
ATACCGATGGCTGCAATGGGTTCGTAATCGGGTCTGTCTAGCTCAAAGTAGTCAGGGTTAGGGATATCTCTGGGTTTCCAGATTCCCTTGTAAGCCGGGT
TATCAATAAGAGGTGAGCTCCATTTGCCCTTGTAAGCAGGATTCCTCTTCATTGGTCTCTTCCATTCACCACAACCAGGTGCTGCTTCACACTTGGGGTT
GTCAATTTTAGGAGCCTCCCACATACCATCTTCCTCATCATCCCAATCTTCAGGTGCATCCTCATCCCAGTCCTCAGGCTTCACGGCATTTGGATCAGGA
ATCTTGGCTCTTTCGTCCCAATCCTCTGGTTTCTTGTCTTCAGGGTCAGGGATGGTCTTGGCAGGGATCAATGCAGGCTCAAAGTCTTCACCAGAGAGTA
AATTGGCCTTTTTCTTCTCCTCTCCATCAACCAAAATTCTAACCTCGTTGTCGGGTTTCAAGATGGCGGTGTAGACATGGGAAAGCTTGTCATAAGGAAC
AGAGGGAGGGAACTTCAGATGGTGTTCAACGTACTCGCCACTCTTGGGATTCTTGTGCTTCAAGATGAAATGCACTTTGTTCGTACCTCCACACTTGTCA
GGCCCAAACATGATAGAGTAAGGGGATTCACTATCGAATCCCTGAGGTGTCCATCCAGCTTCCTGAGGACGGAGGTACTTCAAGTAAGCACCACCACACT
CAAGTCCTTCCTGGAAACGAACCTCGTACTGAAGAACAACAGTTCCTTCCTTGAGGTTTAGAGGCTCGTCAAGCTCTTTCACAATTCCATACTTCCTAGC
CTTCTC