Detailed information on CNT30377782


BLAST search results

BLAST vs Swiss-Prot:
sp|Q8W4H7|EF1A2_ARATH, E-value = 1e-155

BLAST vs NONCODE:
NONBNAT007048, E-value = 0.0

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30672814Arabidopsis thalianaSetaria viridis83.5679.1785.31844forward
CNT30520996Arabidopsis thalianaSetaria italica82.6767.0185.39835forward
CNT30546799Arabidopsis thalianaIpomoea triloba68.3256.1986.09690forward
CNT30274113Arabidopsis thalianaChenopodium quinoa61.6899.8487.16623forward
CNT3021232Arabidopsis thalianaCitrullus lanatus68.5155.982.95692forward
CNT30727585Arabidopsis thalianaCorchorus capsularis68.2251.1186.36689forward
CNT30380230Arabidopsis thalianaManihot esculenta68.2228.484.33689forward
CNT30194937Arabidopsis thalianaPisum sativum68.6169.3783.98693forward
CNT30503993Arabidopsis thalianaNicotiana attenuata23.0784.7388.84233forward
CNT30712097Arabidopsis thalianaGlycine max43.0736.4684.37435forward
CNT30160120Arabidopsis thalianaPistacia vera67.6254.9586.68683forward
CNT30224987Arabidopsis thalianaHordeum vulgare26.6391.1990.33269forward
CNT30541587Arabidopsis thalianaBrassica napus70.160.291.81708forward
CNT30233993Arabidopsis thalianaBrassica oleracea70.8966.6791.62716forward
CNT30173274Arabidopsis thalianaTrifolium pratense68.3251.385.36690forward
CNT30146334Arabidopsis thalianaMedicago truncatula62.9763.9884.43636forward
CNT30310177Arabidopsis thalianaCamelina sativa69.860.7893.9705forward
CNT3077051Arabidopsis thalianaBrassica juncea70.161.3592.37708forward
CNT30265127Arabidopsis thalianaBrassica rapa15.3560.7894.84155forward
CNT30611975Arabidopsis thalianaArabis alpina70.153.0392.09708forward
CNT30600411Arabidopsis thalianaFraxinus excelsior39.699.7584.75400forward
CNT30608730Arabidopsis thalianaGossypium raimondii44.3674.6783.71448forward
CNT30647369Arabidopsis thalianaRosa chinensis39.0143.4984.52394forward
CNT30127375Arabidopsis thalianaCorymbia citriodora51.7893.7383.94523forward
CNT30350898Arabidopsis thalianaEragrostis tef67.9261.5886.01686forward
CNT30151899Arabidopsis thalianaPrunus persica47.2343.2586.79477forward
CNT30424546Arabidopsis thalianaPapaver somniferum84.2672.0685.9851forward
CNT30706337Arabidopsis thalianaPrunus avium65.3556.686.82660forward
CNT3053027Arabidopsis thalianaAmborella trichopoda36.7385.6883.56371forward
CNT3024315Arabidopsis thalianaPopulus trichocarpa62.8783.2282.99635forward
CNT30101006Arabidopsis thalianaOryza rufipogon38.0255.1784.11384forward
CNT30594462Arabidopsis thalianaEragrostis curvula67.6258.6886.38683forward
CNT30723969Arabidopsis thalianaLupinus angustifolius77.5272.5785.19783forward

Expression of CNT30377782

Peptides detected in this lncRNA

>peptide 1 (32 aa)
IIKSLRDIQKGGREKVTEIKRKKKKAQTPSKF*

>peptide 2 (59 aa)
HNKKSQRYPKRRERESHRNKEKKEKGSNAIKVLRTKENHKRVDHNESLIIWHPSSLQPW*

>peptide 3 (62 aa)
MSLTAKRPKGGYSEKVSTTMGLVGVILTIPASPFFKNLGSFSISLPERLSILVKISENLTAM*

>peptide 4 (93 aa)
MMMTWEVKLAAPLAGSSLELEATYPLLRSLTATFLTLNPTLSPGSASRRDSWCISTDLTSVVNPVGAKVTTIPGLIIPVSTRPTGTVPIPPIL*

>peptide 5 (45 aa)
MLSPSNPEIGTNGILSGLYPTFFRYEDTSLMISSYLALEYLGVVAS

Sequence

>CNT30377782
CATAATAAAAAGTCTCAGAGATATCCAAAAAGGAGGGAGAGAGAAAGTCACAGAAATAAAGAGAAAAAAGAAAAAGGCTCAAACGCCATCAAAGTTTTAA
GAACCAAAGAAAACCATAAGAGAGTCGATCATAACGAAAGTCTCATCATTTGGCACCCTTCTTCACTGCAGCCTTGGTGACCTTGGCTCCAGTTGGGTCC
TTCTTGTCCACGCTCTTAATAACACCAACAGCAACGGTCTGCCTCATGTCCCTAACAGCGAAACGTCCCAAAGGTGGGTACTCGGAGAAAGTCTCAACAA
CCATGGGCTTGGTTGGGGTCATCTTAACCATACCAGCGTCACCATTCTTCAAAAACTTGGGCTCCTTCTCAATCTCCTTACCAGAACGCCTGTCAATCTT
GGTCAAGATCTCAGAGAACTTGACTGCAATGTGAGAGGTGTGGCAATCGAGAACTGGGGCGTAACCGTTACCAATCTGACCAGGGTGGTTCATGATGATG
ACCTGGGAGGTGAAGTTGGCGGCACCCTTAGCTGGATCATCCTTGGAGTTAGAGGCAACGTATCCTCTCTTAAGATCCTTGACAGCAACATTCTTGACAT
TGAATCCAACATTGTCACCGGGAAGTGCCTCAAGAAGAGACTCGTGGTGCATCTCAACAGACTTAACCTCAGTGGTCAACCCTGTGGGAGCAAAGGTAAC
AACCATACCAGGCTTGATCATACCAGTCTCAACACGTCCCACTGGCACCGTTCCAATACCACCAATCTTGTAGACATCCTGAAGTGGAAGACGAAGGGGC
TTGTCTGATGGCCTCTTGGGCTCGTTGATCTGGTCAAGAGCCTCAAGAAGAGTTGGTTGACCTCTCAATCATGTTGTCTCCCTCGAATCCAGAGATTGGC
ACAAATGGGATTTTGTCAGGGTTGTATCCGACCTTCTTCAGGTATGAAGACACCTCCTTGATGATTTCATCGTACCTAGCCTTGGAGTATTTGGGGGTGG
TGGCATCCAT