Detailed information on CNT30377662


BLAST search results

BLAST vs Swiss-Prot:
sp|P29402|CALX1_ARATH, E-value = 0.0

BLAST vs NONCODE:
NONATHT003963, E-value = 0.0

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30676354Arabidopsis thalianaSetaria viridis23.3441.8781.52211forward
CNT30281153Arabidopsis thalianaChenopodium quinoa32.4145.0880.89293forward
CNT30728459Arabidopsis thalianaCorchorus capsularis39.3857.4282.87356forward
CNT30629341Arabidopsis thalianaVigna unguiculata34.0728.2182.14308forward
CNT30709122Arabidopsis thalianaGlycine max13.534.6686.07122forward
CNT30164689Arabidopsis thalianaPistacia vera17.1528.1885.16155forward
CNT30561418Arabidopsis thalianaActinidia chinensis55.6449.980.12503forward
CNT30264134Arabidopsis thalianaBrassica rapa93.039790.73841forward
CNT30140632Arabidopsis thalianaLolium perenne14.4964.2284.73131forward
CNT30126269Arabidopsis thalianaCorymbia citriodora17.8142.4881.37161forward
CNT30365925Arabidopsis thalianaSorghum bicolor33.4134.0182.12302forward
CNT30120413Arabidopsis thalianaCitrus clementina33.9637.9581.76307forward
CNT3038556Arabidopsis thalianaCucumis melo39.0544.6879.6353forward
CNT30149228Arabidopsis thalianaBrachypodium distachyon35.467.3780.62320forward
CNT30101562Arabidopsis thalianaOryza rufipogon38.3840.1682.42347forward
CNT30585446Arabidopsis thalianaEchinochloa crusgalli14.7144.0485.71133forward
CNT30116414Arabidopsis thalianaOryza nivara7.8525.3685.9271forward
CNT30333676Arabidopsis thalianaCynara cardunculus20.1335.2781.87182forward
CNT30725707Arabidopsis thalianaLupinus angustifolius32.0852.6382.07290forward
CNT3048947Arabidopsis thalianaCucumis sativus20.813.2984.04188forward

Expression of CNT30377662

Peptides detected in this lncRNA

>peptide 1 (45 aa)
KSQRPSRLSLSRCCQTRYHLALSRSQYRWLQWVRNRVCLAQSSQG*

>peptide 2 (33 aa)
VSATFSSFAIKMLSNKIPSCIVQISIPMAAMGS*

>peptide 3 (40 aa)
MVLAGINAGSKSSPESKLAFFFSSPSTKILTSLSGFKMAV*

>peptide 4 (38 aa)
SLSDLLVFRYQDVVKQDTILHCPDLNTDGCNGFVIGSV*

>peptide 5 (94 aa)
MGKLVIRNRGRELQMVFNVLATLGILVLQDEMHFVRTSTLVRPKHDRVRGFTIESLRCPSSFLRTEVLQVSTTTLKSFLETNLVLKNNSSFLEV*

Sequence

>CNT30377662
AAGTCTCAGCGACCTTCTCGTCTTTCGCTATCAAGATGTTGTCAAACAAGATACCATCTTGCATTGTCCAGATCTCAATACCGATGGCTGCAATGGGTTC
GTAATCGGGTCTGTCTAGCTCAAAGTAGTCAGGGTTAGGGATATCTCTGGGTTTCCAGATTCCCTTGTAAGCCGGGTTATCAATAAGAGGTGAGCTCCAT
TTGCCCTTGTAAGCAGGATTCCTCTTCATTGGTCTCTTCCATTCACCACAACCAGGTGCTGCTTCACACTTGGGGTTGTCAATTTTAGGAGCCTCCCACA
TACCATCTTCCTCATCATCCCAATCTTCAGGCTTGGTCGCTTCGGGGTCGTCGACCTCCTCAGGCTTCACGGCATTTGGATCAGGAATCTTGGCTCTTTC
GTCCCAATCCTCTGGTTTCTTGTCTTCAGGGTCAGGGATGGTCTTGGCAGGGATCAATGCAGGCTCAAAGTCTTCACCAGAGAGTAAATTGGCCTTTTTC
TTCTCCTCTCCATCAACCAAAATTCTAACCTCGTTGTCGGGTTTCAAGATGGCGGTGTAGACATGGGAAAGCTTGTCATAAGGAACAGAGGGAGGGAACT
TCAGATGGTGTTCAACGTACTCGCCACTCTTGGGATTCTTGTGCTTCAAGATGAAATGCACTTTGTTCGTACCTCCACACTTGTCAGGCCCAAACATGAT
AGAGTAAGGGGATTCACTATCGAATCCCTGAGGTGTCCATCCAGCTTCCTGAGGACGGAGGTACTTCAAGTAAGCACCACCACACTCAAGTCCTTCCTGG
AAACGAACCTCGTACTGAAGAACAACAGTTCCTTCCTTGAGGTTTAGAGGCTCGTCAAGCTCTTTCACAATTCCATACTTCCTAGCCTTCTCACTCACGA
GAAG