Detailed information on CNT30376617


BLAST search results

BLAST vs Swiss-Prot:
sp|P69309|UBIQP_AVEFA, E-value = 0.0

BLAST vs NONCODE:
NONMEST001181, E-value = 8e-115

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30729082Arabidopsis thalianaCorchorus capsularis51.4457.2684.96552forward
CNT30200107Arabidopsis thalianaPisum sativum73.0788.4981.89784forward
CNT3094992Arabidopsis thalianaSolanum tuberosum73.8168.0484.34792forward
CNT30147063Arabidopsis thalianaMedicago truncatula72.8871.2281.84782forward
CNT30477817Arabidopsis thalianaArabidopsis halleri74.0974.388.3795forward
CNT30356895Arabidopsis thalianaLactuca sativa72.7982.0482.46781forward
CNT30120688Arabidopsis thalianaCitrus clementina73.6372.3482.66790forward
CNT30334109Arabidopsis thalianaCynara cardunculus70.0846.8282.71752forward
CNT30114619Arabidopsis thalianaEutrema salsugineum74.0973.5487.55795forward

Expression of CNT30376617

Peptides detected in this lncRNA

>peptide 1 (60 aa)
MKGGLLLDIVVSKSSAILQLLSGEDQPLLVRRNTLFVLDLGLDVVDGVRTLHLKSNRLSR*

>peptide 2 (73 aa)
MRRCWSGGIPSLSWILALTLSMVSELSTSRPKFFHLQVAFRRRSISAGPVGYPLCPGSWLSRYQWCQNSPPPK*

>peptide 3 (37 aa)
MVSELSTSKVMVFPVRVFTKICIPPRRRKTKWSVDSF*

>peptide 4 (40 aa)
MVSELSTSRVIVFPVRVLTKICIPPRSLRTKWRVDSFWIL*

>peptide 5 (31 aa)
MVSELSTSKVIVFPVNVLTKICIPPRSLRTR*

Sequence

>CNT30376617
GCCCCAAAACACAAACCACCAAAGTTTTACATGAAACGAAACATTGAACTTCTTAAGCATAACAGAGACGAGATTTAGAAACCACCACGAAGACGCAGGA
CCAAGTGAAGAGTAGACTCCTTCTGGATGTTGTAGTCGGCCAAAGTACGTCCATCCTCAAGCTGCTTTCCAGCGAAGATGAGACGCTGCTGGTCCGGAGG
AATACCTTCCTTGTCCTGGATCTTGGCCTTGACGTTGTCAATGGTGTCGGAGCTTTCCACTTCAAGGCCAAAGTTCTTCCATCTTCAAGTTGCTTTCCGG
CGAAGATCAATCTCTGCTGGTCCGGTGGGATACCCTCTTTGTCCTGGATCTTGGCTTTCACGTTATCAATGGTGTCAGAACTCTCCACCTCCAAAGTGAT
GGTCTTTCCGGTGAGAGTCTTCACGAAGATCTGCATACCTCCACGCAGACGCAAGACCAAGTGGAGTGTGGACTCCTTCTGAATGTTGTAGTCGGCCAAA
GTTCTGCCATCTTCAAGTTGTTTTCCGGCGAAGATCAATCTCTGCTGGTCCGGAGGAATACCCTCTTTGTCTTGGATCTTGGCTTTCACGTTATCAATGG
TGTCAGAACTCTCCACCTCCAAAGTGATAGTTTTCCCAGTCAACGTCTTAACGAAAATCTGCATACCACCACGGAGCCTGAGAACAAGATGAAGGGTGGA
CTCCTTCTGGATATTGTAGTCAGCAAGAGTTCTGCCATCCTCCAACTGCTTTCCGGCGAAGATCAGCCTCTGCTGGTCCGGAGGAATACCCTCTTTGTCT
TGGATCTTGGCCTTGACGTTGTCGATGGTGTCAGAACTCTCCACCTCAAGAGTAATCGTCTTTCCCGTTAGGGTTTTAACGAAAATCTGCATACCACCAC
GGAGCCTGAGGACCAAGTGGAGGGTGGATTCCTTCTGGATATTGTAATCAGCCAACGTACGGCCATCCTCTAGCTGCTTGCCGGCGAAAATAAGCCTCTG
CTGATCCGGAGGAATGCCCTCCTTATCCTGGATCTTGGCCTTAACGTTGTCGATGGTGTCGGAGCTTTCCACC