Detailed information on CNT30376478


BLAST search results

BLAST vs Swiss-Prot:
sp|O81472|MP3K2_ARATH, E-value = 5e-36

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30479136Arabidopsis thalianaArabidopsis halleri90.6651.192.69301forward

Expression of CNT30376478

Peptides detected in this lncRNA

>peptide 1 (73 aa)
ETQIGEVLDTVLEESPSFVVNEHASSVVSSNWINISPVSSFSTLSSSASSSSQPFSEEEEELGRLTISLSGAK*

Sequence

>CNT30376478
CAGAGACACAAATCGGTGAGGTATTGGATACTGTACTTGAGGAGTCACCCTCGTTTGTAGTGAATGAGCATGCCTCATCAGTCGTATCCTCCAACTGGAT
AAACATATCTCCCGTCTCTTCCTTTTCCACTTTGTCATCCTCGGCTTCTTCTTCATCACAACCATTTTCGGAAGAAGAAGAGGAACTCGGCCGCCTAACT
ATTTCACTATCAGGAGCAAAATGAGTAAGGATATCCCAAGATGATCCCGGAAGATCAACTGGAGGTAGTTTCATCACCGGAGGAGGCTTAAGTACCGATG
GTCTTACCCCCTTAATACCACCACCAACACCA