Detailed information on CNT30376233


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONATHT002607, E-value = 0.0

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT30376233

Peptides detected in this lncRNA

>peptide 1 (38 aa)
MRSSDETQIFISDQRLTESNSKNRDEIAIEWKIIEETE*

Sequence

>CNT30376233
GAGTCTTAACAAAGATCTGCATCTGTAATTCACAAAAAACTGAGATTAATCGCTTGGATAATCTCAAATCCGATTAAAAAAGCTACCACCAGATCTGAAT
ATAAATCACATATCGGATCAAATTCAAAGAATCGACGCCTAAATATACAAATCTGTGAAATCTACGAACCCTAGTTCAGAATATAGATGAGATCTAGCGA
TGAAACTCAGATATTTATCTCCGATCAAAGATTAACCGAATCAAACTCAAAGAACAGGGACGAAATTGCGATCGAATGGAAAATAATCGAAGAAACTGAA
TAAGAACCCAGAAATTTACCTTGATCCCGATTGAGAGATTTGA