Detailed information on CNT3037459


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONCQUT004405, E-value = 2e-74

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT3037459

Peptides detected in this lncRNA

>peptide 1 (69 aa)
DVRALSSHWTLPPAEPFSRVGRLLNRKDNSSRGPRRRLRNPLRCRQPPRPGSGILTRFPFEVRAVALSDG

Sequence

>CNT3037459
CGACGTGCGTGCTCTTTCCAGCCACTGGACCCTACCTCCGGCTGAGCCGTTTTCCAGGGTGGGCAGGCTGTTAAACAGAAAAGATAACTCTTCCCGAGGC
CCCCGCCGACGTCTCCGGAATCCCTTACGTTGCCGTCAGCCGCCACGTCCCGGTTCAGGAATTTTAACCCGATTCCCTTTCGAAGTTCGCGCTGTCGCGC
TATCAGACGGGTT