Detailed information on CNT30374346


BLAST search results

BLAST vs Swiss-Prot:
sp|P15688|NU2M_BETVU, E-value = 3e-144

BLAST vs NONCODE:
NONORUT000579, E-value = 1e-82

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30532270Arabidopsis thalianaEucalyptus grandis2.3438.489.0191reverse complement
CNT30635976Arabidopsis thalianaCapsicum annuum6.2979.5587.76245reverse complement
CNT30187165Arabidopsis thalianaSecale cereale5.2997.1789.32206reverse complement
CNT30393404Arabidopsis thalianaTriticum turgidum2996.4192.741129forward
CNT30592538Arabidopsis thalianaMusa acuminata6.1423.1895.4239forward
CNT30439321Arabidopsis thalianaAegilops tauschii4.3983.0192.4171forward
CNT30655393Arabidopsis thalianaRosa chinensis5.0929.8290.91198reverse complement
CNT30627909Arabidopsis thalianaDaucus carota31.9589.3795.741244forward
CNT30722552Arabidopsis thalianaTriticum spelta2.846.5892.66109reverse complement
CNT30574572Arabidopsis thalianaVitis vinifera61.3935.4993.12390forward
CNT30705826Arabidopsis thalianaPrunus avium6.9482.5795.19270forward

Expression of CNT30374346

Peptides detected in this lncRNA

>peptide 1 (32 aa)
MRNASQFCPFFLSPSIKQNDQKGSLLASYSRL*

>peptide 2 (43 aa)
MRVSFVHFFYPPLSNKMIKKEVYWLLILVFDLFHLCLARCHLY*

>peptide 3 (41 aa)
MEKVIAEIGFVLARAPKSAIYLTRVCRNAETMANASIVINA*

>peptide 4 (45 aa)
HIGSTRETSTKSNHQEVPVPQTALCTFPVRGRLLQSYFEKHRSFP*

>peptide 5 (44 aa)
MDFAVLSQLKKKRLYHIEMSIRFPPPMRWGICNPLFLLWGPSSF*

>peptide 6 (48 aa)
MEDSILAGSMPVVSEKFDVLAYLSLQILPLQRPFTFFLFVLECHLMSN*

>peptide 7 (47 aa)
TSEALERLRQSQITRKFPSHKQRCVHFLLGGDFSNPTLRSTVPSPKE*

>peptide 8 (92 aa)
MDPFLSVVASAFPGRAGIFDYYSNGQAKAAGCYPNRPAGGTRRGSGNHSTAVEKACSLQITRTISHIQGSLPQEPHPIQLVGGAVRLLNQTK*

>peptide 9 (53 aa)
MRFARHWRFALLLFFIGRFGSDGLRRSFPTKKEKAVSHRDVDSFSAPNEMGNL*

>peptide 10 (36 aa)
MKKEVIASSNDLLRSIGSYRIHVLGVSKNILFTKRI*

>peptide 11 (36 aa)
MGRQRPQAAIPIGQRAERGEAPAIIAPRSKKRAPFR*

Sequence

>CNT30374346
CACATCGGAAGCACTAGAGAGACTTCGACAAAGTCAAATCACCAGGAAGTTCCCGTCCCACAAACAGCGTTGTGTACATTTCCTGTTAGGGGGAGACTTC
TCCAATCCTACTTTGAGAAGCACCGTTCCTTCCCCTAAAGAGTGAGGAACCATCCTATTTGGCCAAGCTCTTTACAGCAAGCCAAGGGCAAAGCTCCACC
AGTTGTGAGTCATAAGTCGAGCAAGCAAGAACGGAAACGCAGCAAACTAGGTCAAAGGAATTCCTCGAACCTTAGGCGGAGCCCATGTTTCCCCCGATGC
ATACAAGTCTGAATCCCAAACATCTATCTGTTAGTCATTGGCTGGCAAGAAGAGGACCCCTTGGCTGCTGACAAGTGTTGGCAAGTGCTGCTAGCGGTTC
CGCAGCTCTCCTTCGTTACTTTATTTAGAACTCCTGTTGTTGAAGAGAGAGCATTCACCGAAAATGGAAGATTCTATTCTTGCTGGTAGCATGCCAGTTG
TGAGTGAGAAATTTGATGTATTGGCTTACCTTTCCCTACAAATCTTACCTCTCCAGAGGCCATTTACCTTCTTTCTCTTTGTGTTGGAATGCCATTTGAT
GAGTAACTGAGAACAAAGGAGAGGGGTATAGCAAGGATGAAGTAATGAAAAAGGAAGTCATTGCTAGTAGTAACGACTTATTACGATCCATTGGTTCATA
TAGAATCCATGTCCTAGGTGTATCAAAAAACATTCTTTTCACTAAGCGTATATAATAAAATAGAGTGAAAAAGGGTCCACCCCGAAACCAAGGGGATACT
AACTAACAGCTGAGTCCTCTCCAAACCGCAGGAGATAGTTGCCCATCATACGGCTCACCAACTTGCCTCTATGGGAGGCTCACTCCGGGCAGGTTCGGAT
CACTTATGATACAAAGCTCGGAGAAGGAAGGGGTTAGGTTAGGAACGCAGTAACTCGACCCCTCATCAACTAATTAATGAGACCTTATCCTTGGGAGAGG
GCCAAAGGCACTCGACTAAAAGGTTAAAAGATCTCGACTGAAAAGGAGAGGGCGAAGTCATGACTCGAGCACTTGTTGCGAGAGGTCCATAGGAACAAAG
GAGCTCGACTGTAAGGAAAGGAACGAGAGTGAAACGAGAGGAGAGGTGAGGTTTTCAATATGATTCTTTTTTCGTATTTGTTCGATGAGAAATGCGAGTC
AGTTTTGTCCATTTTTTCTATCCCCCTCTATCAAACAAAATGATCAAAAAGGAAGTTTACTGGCTTCTTATTCTCGTCTTTGATCTCTTCCATCTCTGCC
TCGCTCGTTGTCACCTATATTGAAGAAAGAAACCCTGTAGAGAATGAAGAGGGGCCTAGGATCTTCTTCTCAACAGTGCTTCTCGAGGCTCCCCCCCTGA
ATAAGTAAGGCCCCGTTAGCCTGGGCGAAGATGGGGATAAGGAATAAGGATTGAAGCCCCCTTAGCTCTGCCAGGCACTGGACAGGGGTTAGCTCGGTAA
ATGTGTAGAGCCAAGTGTAGTATGGTGTAGTAGTAGTAGGCACTTCTAGGCCCCTTCCCGGCTACTGGATCACTCCAGTGCTTTGGGTACTACGGACCCT
CTGCCATCCATTACAGCAGAGCCGTTTCATGAGCGGGGGGGCTAGGCGCAGTTCTTTGAATCAAACGTTGAATGAAATCGATTCTTTTTTAGATATCAAA
ATGGAAATCGGATAGGATAGATGGATGGATCTATCTTTCCATTTATATATTACTAAAGGATTTATATAGTTAAGTATCGTAGCAAGAAGCCCCAAATCCT
TGATTTGGCCAGGAAAGACTGCACTGCTTTGGGCCCAGGATGCGAAGGGAATGAGCTCGGCTGCTTCTCCTCCACACTGATTTTTCTCCGTGCCTGCTCC
GCATGCGCTTCGCGCGCCATTGGCGCTTTGCTCTCCTCTTATTCTTCATTGGACGGTTCGGTTCGGATGGACTTCGCCGTTCTTTCCCAACTAAAAAAGA
AAAGGCTGTATCACATCGAGATGTCGATTCGTTTTCCGCCCCCAATGAGATGGGGAATTTGTAACCCCCTATTTCTACTTTGGGGCCCTTCATCTTTCTG
AATCTAGGCCCGTCCCGGCTCGTGTCGTTCCAACAACCGGCGGGGAGCATCTCAGTATACGATCGCGCGCAGTAACTGGGAGTCCTATTACACCTAAGGC
GAACTTCAATTCACCAAACCAAGGTTCATCTCGTGTAGTGATTGTGGACTCTACTAAGGATATTGAGTAGACGGTTGATGTATCAGACTCGACCCTATCT
TTCGTAGCATGCATTCCCATCGGTGTCGCAACTGATTCGGTAAGCTACGTGTCCGGTGCACGGAGAACTGCCTTCGGTCCTCCAAACTTACTTATTCGTG
GCAACCTTCCGGCCGCCCAACGACCTATAACGCTAGTCACTACTCCCACTGGGGCTAGAAAGTAAGCCCCACAACCCAAAGCGGCGAAGAACAAATAGAA
TTTGCTACAAAAGCCGGCTAACGGGGGTATTCCTGCGTATGAGAACATAGTAATGGAGAAGGTAATAGCCGAAATAGGATTCGTTTTGGCTAGAGCGCCC
AAATCCGCTATATATTTGACACGGGTTTGCCGTAATGCTGAAACTATGGCGAATGCATCCATCGTCATTAATGCATAAATAAAGATACCAATTAGTAGTG
ATTGAATTCCTTCTATGGTTCCACATGAGAAACCAGTACGAATATAACCTACATGTCCAATTGAACTATGAGCTAGAGGTCTTTTGACTTTCGTTTGGGC
CATGGCGGCCAGTGCTCCTAAGATCATAGAAGCAATGCTGCAGAAAAAGAAGATTTGTTGCAATGTAGCTCCATAGGAACCATAAATAGAAACACGTAAA
ATATTAGCAGAAATAGAGATTTTAGGCGCAATAGAAAGGAATGCTGTAACCGGGGTGGGTGAACCCTCATAGATATCTGGTGCCCACATATATAGAGTCA
AAGGGAATATGGAGTCCGAGGGGGAGGGGGTTTTCTTCGGGGCTCGAGAGATTGAATAGACCCACAAGTTTGAAATTCGCCACTGGGGAATTCACACGAA
AGGGAACGAGGAATTCTCAACGAAAAAAGTGCTCTCTGAACCGAACGTGAAAGTTTTTTTCCATCAGACGGCTGTTCCTGTAACTCCACTCTCGACTTGG
ATTATATATCCAAAAAGGTCCGCTCTCGGCCATTCCACACGCTGCCTAGCCGAGGTGTGGTTTCTGAAGTGGATTCTCTCTTTTCTAGTAGATGCCGAAC
CTGCTGCCCCATTGACTAAGAAGAGGGGCGGGCGCAGCAGCTACATGGACCCCTTCCTTTCTGTTGTTGCCAGCGCTTTCCCGGGCCGAGCCGGAATTTT
TGATTATTATTCTAATGGGCAGGCAAAGGCCGCAGGCTGCTATCCCAATAGGCCAGCGGGCGGAACGAGGAGAGGCTCCGGCAATCATAGCACCGCGGTC
GAAAAAGCGTGCTCCCTTCAGATAACACGCACCATTTCTCATATCCAAGGCAGCTTACCACAAGAACCCCACCCCATACAACTAGTTGGGGGGGCTGTTC
GCCTTTTGAATCAAACAAAGTAAGTTGTAGGTAGGGGCTTCATAGCTACTTTCATTCTAAAGGAAAGCGAAGAACCAATCTTTAGTCAATAGGAGCCCTA
CTTCCCTCGACCTCATCACTTCAATTGTTGCGCAAACCTCTTTCTTAGTCACCGGGCGGAGCGCACCTTTGTCACAGTAGGGCGAGCTGTTTGATAGTGA
CTTCTTGCGTTTGGTAGGGCGACGAAAGGGCTACTTCCTTCAATCTAGGAAACAGCCGGAAACTCGAGAAGGTCGCCTTTGGAAGCGTTCGCC