Detailed information on CNT30374078


BLAST search results

BLAST vs Swiss-Prot:
sp|P59232|R27AB_ARATH, E-value = 1e-90

BLAST vs NONCODE:
NONGMAT000502, E-value = 5e-44

Expression of CNT30374078

Peptides detected in this lncRNA

>peptide 1 (40 aa)
EHKNIHKKNLDMKFKQVQHKIHNIQKQLPNSKKKAVFNSK*

Sequence

>CNT30374078
AAGAGCATAAAAATATCCATAAGAAAAACCTAGATATGAAATTCAAACAAGTTCAACATAAGATCCACAACATCCAAAAACAACTTCCAAATTCCAAAAA
AAAAGCAGTATTCAATTCAAAATGATAGAGATCGAGATGAAAATCATTCCTGAGCTCCTTCTTTCTGGTAAACGTAGGTGAGACCACACTTACCACAGTA
GTGACGATCGAAATGACTCGCCATGAAAGTCCCAGCACCACAGGTTGCGTTAGGGCACTCCTTCCTCAAACGCTGAACCTTACCTGAACCATCAACCTTG
TAGAACTGAAGAACAGCGAGCTTGACCTTCTTGTGCTTGGTGTAGGTCTTCTTCTTCCTCTTCTTAGCACCTCCACGGAGACGAAGGACAAGGTGAAGCG
TTGATTCCTTCTGGATGTTGTAATCGGCTAAGGTACGTCCGTCTTCGAGCTGCTTTCCGGCGAAAATCAATCGCTGCTGGTCCGGTGGGATTCCTTCCTT
GTCTTGGATCTTGGCCTTGACATTGTCGATGGTGTCAGAGGACTCGACCTCGAGAGTGATCGTCTTCCCCGTTAGGGTTTTCACGAAGATCTGCATCTTT
TTTTGCTTTTACG