Detailed information on CNT3037370


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONCQUT004405, E-value = 0.0

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30628223Cucumis meloDaucus carota58.5799.695.43984reverse complement

Expression of CNT3037370

Peptides detected in this lncRNA

>peptide 1 (40 aa)
MQPQSGGKFCPRLNMGERPIANKYREGKMKRTLKRESNSA*

>peptide 2 (41 aa)
LSTRPQVRRDYPLSLSISISGGKETYKDSPSNGERTGKSPA*

>peptide 3 (51 aa)
MRIETAAYAQAFVTPVETSPSRSWLAARAFWRASASVRSWHRPVGSPFDPS*

>peptide 4 (55 aa)
MDGCWSIKTAGRWSWKSKSAKECVTTHLPNQLAPKMDGAEARDLYPAVGARARPR*

>peptide 5 (29 aa)
LDATPGQAGLPAEFKHINKRRKRNLQGFP*

>peptide 6 (85 aa)
MCPSRMWNGDEPVRQSTWGMDRCGLRRRPTPRPLLRLWRRRRHDRGWQRAPSGGLRHLCAPGIGLWAPHSTRLETRTKESDMCAS*

Sequence

>CNT3037370
CTCTCGACGCGACCCCAGGTCAGGCGGGACTACCCGCTGAGTTTAAGCATATCAATAAGCGGAGGAAAAGAAACTTACAAGGATTCCCCTAGTAACGGCG
AGCGAACCGGGAAGAGCCCAGCTTGAGAATCGGGCGTCCTCGACGTCCGAATTGTAGTCTGGAGAAGCGTCCTCAGCGGCGGACCGGGCACAAGTCCCCT
GGAAGGGGGCGCCAGAGAGGGTGAGAGCCCCGTTGCGCTCGGACCCTGTCGCACCACGAGGCGCTGTCAACGAGTCGGGTTGTTTGGGAATGCAGCCCCA
ATCGGGCGGTAAATTCTGTCCAAGGCTAAATATGGGCGAGAGACCGATAGCAAACAAGTACCGCGAGGGAAAGATGAAAAGGACTTTGAAAAGAGAGTCA
AATAGTGCTTGAAATTGTCGGGAGGGAAGCGGATGGGGGCCGGCGATGTGCCCCAGTCGGATGTGGAACGGTGATGAGCCGGTCCGCCAATCGACTTGGG
GCATGGACCGATGCGGATTGAGACGGCGGCCTACGCCCAGGCCTTTGTTACGCCTGTGGAGACGTCGCCGTCACGATCGTGGCTGGCAGCGCGCGCCTTC
TGGCGGGCTTCGGCATCTGTGCGCTCCTGGCATCGGCCTGTGGGCTCCCCATTCGACCCGTCTTGAAACACGGACCAAGGAGTCTGACATGTGTGCGAGT
TAACGGGCGAGTAAACCCGTAAGGCGCAAGGAAGCTGACTGGTGGGATCCCCTAGTGGGTTGCACCACCGACCGACCTTGATCTTCTGAGAAGGGTTCGA
GTGTGAGCATGCCTGTCGGGACCCGAAAGATGGTGAACTATGCCTGAGCGGGGCGAAGCCAGAGGAAACTCTGGTGGAGGCCCGTAGCGATACTGACGTG
CAAATCGTTCGTCTGACTTGGGTATAGGGGCGAAAGACTAATCGAACCGTCTAGTAGCTGGTTCCCTCCGAAGTTTCCCTCAGGATAGCTGGAGCCCGCG
GGCGAGTTCTATCGGGTAAAGCCAATGATTAGAGGCATCGGGGGCGCAACGCCCTCGACCTATTCTCAAACTTTAAATAGGTAGGACGGTGTGGCTGCTT
TGTTGAGCCACACCACGGAATCGAGAGCTCCAAGTGGGCCATTTTTGGTAAGCAGAACTGGCGATGCGGGATGAACCGGAAGCCGGGTTACGGTGCCTAA
CTACGCGCTAACCTAGATCCCACAAAGGGTGTTGGTCGATTAAGACAGCAGGACGGTGGTCATGGAAGTCGAAATCCGCTAAGGAGTGTGTAACAACTCA
CCTGCCGAATCAACTAGCCCCGAAAATGGATGGGTGTTGGTCGATTAAGACAGCAGGACGGTGGTCATGGAAGTCGAAATCCGCTAAGGAGTGTGTAACA
ACTCACCTGCCGAATCAACTAGCCCCGAAAATGGATGGCGCTGAAGCGCGCGACCTATACCCGGCCGTCGGGGCAAGAGCCAGGCCCCGATGAGTAGGAG
GGCGCGGCGGTCGCTGCAAAACCTTGGGCGTGAGCCCGGGCGGAGCGGCCGTCGGTGCAGATCTTGGTGGTAGTAGCAAATATTCAAATGAGAACTTTGA
AGGCCGAAGAGGGGAAAGGTTCCATGTGAACGGCACTTGCACATGGGTTAGTCGATCCTAAGAGACGGGGGAAACCCGTC