Detailed information on CNT30373064


BLAST search results

BLAST vs Swiss-Prot:
sp|Q42547|CATA3_ARATH, E-value = 4e-66

BLAST vs NONCODE:
NONBNAT004861, E-value = 2e-77

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30317874Arabidopsis thalianaCorylus avellana20.3247.5481.9116forward
CNT30516671Arabidopsis thalianaJuglans regia18.5622.6583.96106forward
CNT30501026Arabidopsis thalianaCoffea canephora28.910.8183.64165forward
CNT30282683Arabidopsis thalianaChenopodium quinoa50.6131.3879.58289forward
CNT3098188Arabidopsis thalianaSolanum tuberosum35.0340.3279.5200forward
CNT30398713Arabidopsis thalianaTriticum turgidum19.9641.9183.33114forward
CNT30542456Arabidopsis thalianaBrassica napus50.0966.292.66286forward
CNT30238041Arabidopsis thalianaBrassica oleracea46.7635.1391.76267forward
CNT30511681Arabidopsis thalianaSolanum lycopersicum19.4433.4384.68111forward
CNT30668910Arabidopsis thalianaTriticum dicoccoides19.9640.5783.33114forward
CNT30313764Arabidopsis thalianaCamelina sativa49.9141.5593.68285forward
CNT3080335Arabidopsis thalianaBrassica juncea23.1223.2891.67132forward
CNT30263082Arabidopsis thalianaBrassica rapa50.6186.2783.74289forward
CNT30611006Arabidopsis thalianaArabis alpina47.9990.1395.62274forward
CNT308572Arabidopsis thalianaZea mays19.9639.3182.46114forward
CNT30368346Arabidopsis thalianaSorghum bicolor19.9642.2282.46114forward
CNT30359648Arabidopsis thalianaLactuca sativa20.493083.76117forward
CNT30154268Arabidopsis thalianaPrunus persica20.4924.5884.62117forward
CNT30570453Arabidopsis thalianaVitis vinifera26.0933.9485.23149forward
CNT30704833Arabidopsis thalianaPrunus avium20.4916.3982.91117forward
CNT3022395Arabidopsis thalianaPopulus trichocarpa43.7860.8380250forward
CNT30119031Arabidopsis thalianaCitrus clementina37.328.0680.75213forward

Expression of CNT30373064

Peptides detected in this lncRNA

>peptide 1 (53 aa)
LLISVHEVHKTFMVIVVVSTFGSIDWKLQIIRSKAMSLSVTISKDPTLEQLVV*

>peptide 2 (41 aa)
MGDFKETLSTDSSSMNHSLRDPLSGEISNLLDQMIILKKNRT

Sequence

>CNT30373064
CTCCTCATCTCTGTGCATGAAGTTCATAAAACCTTCATGGTGATTGTTGTGGTGAGCACATTTGGGAGCATTGACTGGAAGCTGCAAATAATTCGGTCCA
AGGCGATGTCTCTGAGTGTCACCATAAGCAAAGATCCTACACTGGAGCAGCTTGTCGTCTGAGTAGTAGATTCCAGGAACCACAAGACCCGGGTTGAACG
CAAGCTGCTCAGTTTCATTGAAGAAATTGTCAATGGTCCTGTTCAGAACCAAGCGACCAACCGGTTGCAGAGGCAAAATATCCTCAGGCAAGTGGGACAT
GTAGTCCAGAATCCTCCAGTACTCTTGGATGTTTGTTTTCGGGTTAGGTTTCAACGCGTGGACAACGGTGGAGAAACGGACAATAACCGGAGTTTGAACA
CCAGGGGCTCTGAGAAAATCAGCACAAGTGAGGTTTGAAATGTCATGGGTGACTTCAAAGAAACCCTTAGCACTGATTCCTCTAGCATGAACCACTCTCT
CAGGGATCCTCTCTCTGGTGAAATTAGCAACCTTCTCGATCAAATGATAATCCTCAAGAAGAACCGGACCT