Detailed information on CNT30371838


BLAST search results

BLAST vs Swiss-Prot:
sp|Q9ASR1|EF2_ARATH, E-value = 2e-138

BLAST vs NONCODE:
NONGMAT000778, E-value = 7e-20

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT3019597Arabidopsis thalianaCitrullus lanatus23.7341.8479.87313forward
CNT30224354Arabidopsis thalianaHordeum vulgare30.176.4982.62397forward
CNT30561656Arabidopsis thalianaActinidia chinensis37.9835.7982.44501forward
CNT3085191Arabidopsis thalianaVigna radiata21.1538.9181279forward
CNT30143750Arabidopsis thalianaMedicago truncatula25.0243.0886.06330forward
CNT30309793Arabidopsis thalianaCamelina sativa44.6675.7191.68589forward
CNT30612508Arabidopsis thalianaArabis alpina89.0846.389.621175forward
CNT3014085Arabidopsis thalianaZea mays19.1841.4882.61253forward
CNT30605685Arabidopsis thalianaGossypium raimondii27.647.6481.59364forward
CNT30596122Arabidopsis thalianaOryza meridionalis48.6792.7780.69642forward
CNT3024028Arabidopsis thalianaPopulus trichocarpa25.0944.7984.29331forward
CNT30575986Arabidopsis thalianaOryza barthii30.5534.1281.89403forward
CNT30497701Arabidopsis thalianaDigitaria exilis16.9168.6284.3223forward
CNT30604019Arabidopsis thalianaOryza punctata19.1874.8583253forward

Expression of CNT30371838

Peptides detected in this lncRNA

>peptide 1 (48 aa)
MGLASMYRRLCLLGDLLITVRVDLSQTVSRKETTGSDLIISAPPMKSS*

>peptide 2 (48 aa)
KSKKHSGDGERKVFTIRHTIRVLIKQDKIKIERVATIGKKASTSLGEA*

>peptide 3 (35 aa)
MCSPDSSIVHTTIGSDLANLLRPSTNLGRSDATLH*

Sequence

>CNT30371838
AAAAAGTAAAAAACATTCAGGGGATGGCGAGAGAAAAGTCTTCACAATCCGTCATACCATAAGAGTATTAATAAAACAAGACAAAATTAAGATAGAGAGA
GTAGCAACCATTGGGAAAAAGGCTAGTACGAGTCTTGGTGAAGCTTAAAGCTTGTCTTCGAACTCAGATAGTGGAGTCATCGCTTCCTTCAATCCCTTCC
TCTTCCTGATATCAGCCACCAAAACTGAAGCCTGAGTACCTGGCTCAAGAGGGTCAGAAGACATCATTTCCCAATGATCAAACACACACTGTGGGAATGC
CTGTCCTGAGGTTGCTGCCCTAAGCTGACTTGAGAATCCGAAAGACTCCACAACAGGCAGGTATGCCTTGATGTTGTACAAGGGAGTTCCTGGCCTCTGC
ATCTCCTCGAACACGTGTCCACGCTTCTGATTCAGCACACTGTAGATTCCTCCAAGAGCTCCCTCTGGTGCCTGGATCTCAACCATGTAAACCGGCTCCA
AAAGTCTGGGCTTAGCTGTGATCTGGGAAGCGTATATGACCCTTCTGGCTGTGGGGATAACCTGACCACCTCCTCTGTGGATGGCATCAGAGTGAAGCAC
CACATCACATACCTCAAAACAGATACCTCTCATGTTCTCTTCAGCAAGAGGACCTTCCTTGGACGCCCACTGGAAACCAGCAACAACTGAATCCTTGATT
TCGTTAAGGTACTGAACTCCCTTACACATATCGACAACCATGTTAGGCCCTGTGGTTTCAGATCCTTGTCCCATCCAAACTCCTCAGCCAAGATCTTGGA
TCTGATCTTAGGGTCATCCCTTGGGCCAATACGTCCATCATCAATAGCCTCAGCTAGACCTTCCTCCATGGGTCTTGCTTCCATGTACAGACGGTTATGC
TTGTTAGGAGACTTACTCATAACTGTGCGAGTAGATCTATCACAAACTGTCTCACGGAAGGAGACCACAGGGTCTGACTTGATAATTTCAGCACCACCCA
TGAAATCATCCTGAAGATCCTTAAGACAAATCTCAAGATGGAGTTCTCCTGCACCAGCAACAATGTGCTCACCTGATTCCTCCATTGTACACACAACCAT
AGGATCAGACTTGGCCAACCTCTTGAGACCCTCAACCAACTTGGGAAGGTCAGACGCAACCTTACACTGAACAGCAACACGAACAACAGGAGACACAGAA
AACTTCATAGCACGAATGGGGTGAGCATCAACTTCCTTCTCATTAGTCAATGTAGCATTCTTGGTGATGAACTGATCCAGCCCAACCATAGCAACAGTGT
TACCACAAGGGACATCCTC