Detailed information on CNT3036805


BLAST search results

BLAST vs Swiss-Prot:
sp|Q9LUZ4|C3H66_ARATH, E-value = 3e-45

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT3036805

Peptides detected in this lncRNA

>peptide 1 (31 aa)
MAATIRGVLSSYPIFLEPKILPYHKLASSIS*

>peptide 2 (38 aa)
IPFLMSGSERSTGYSFFSVPSREARRVESSSGSNVSLS*

Sequence

>CNT3036805
AGATTCCGTTCTTGATGTCCGGAAGTGAGAGATCGACTGGATACTCTTTCTTCTCCGTCCCATCTCGAGAAGCTCGAAGGGTTGAAAGCTCCAGTGGCTC
CAATGTTTCTCTCTCGTAAAATATTGCCTCAGATGAACTAAGACCTTCTTCATGACCATTTAGCAATTGTTGTAATGTTTTTTTCCTTGAATGAAAGGCT
GAAGTAAAATCAGGAGCAATCAAATCACCAGCAACAGCACAATGGAGAGTCGTTACGCCATCTGAACCACAAGCTCTATTAACATCGACACGACCACTGT
GAAGGATATAAGACAGAACATTCAGGCTCCCAAACATGGCTGCAACCATAAGAGGAGTCCTTTCTTCATACCCCATCTTTTTAGAACCAAAAATCCTCCC
ATACCACAAACTTGCCTCATCAATATCATGACCATCTTCCTCAACAGCACTCCTAAATCCAATCAAATCATCTGTAGCTGAAAATTCAAGCAAAACAGAG
ATA