Detailed information on CNT3036798


BLAST search results

BLAST vs Swiss-Prot:
sp|P0CH33|UBQ11_ARATH, E-value = 1e-153

BLAST vs NONCODE:
NONMEST001181, E-value = 2e-110

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30547563Cucumis meloIpomoea triloba29.6292.0381.42635forward
CNT3020165Cucumis meloCitrullus lanatus32.5140.4891.97697forward
CNT30406246Cucumis meloBeta vulgaris29.6694.7882.39636forward
CNT30200687Cucumis meloPisum sativum28.9694.3883.25621forward
CNT3096742Cucumis meloSolanum tuberosum28.9254.0583.87620forward

Expression of CNT3036798

Peptides detected in this lncRNA

>peptide 1 (37 aa)
MVSELSTSNVIVFPVNVFTKICIPPRNRSTKCNVDSF*

>peptide 2 (30 aa)
MKKKHDEMGKAGFEGKFGRQRIRDKEGVNL*

>peptide 3 (40 aa)
MVSELSTSRVMVLPVRVFTNICIPPRSLSTKWSVDSFWIL*

>peptide 4 (39 aa)
MERQGIERIIQSIKKLGRNFNFSVQFFNQTPLPHFLVPS*

>peptide 5 (50 aa)
MPWEKKQTRFQSFLCERCKKTEKLKSTHKKRSKIELEGRKTTRETIKQQL*

>peptide 6 (85 aa)
MECRFLLDIVIGKRSAVLKLLTSKDKPLLVGWNALFILNLCLNIVNCIRAFHLEGDCFASESFYEYLHLLRNQFNAWPQYENVIT*

>peptide 7 (41 aa)
MKRENRETPRNAKSIGEENNKGSDTQQHEKRNRNKNGTTRN*

>peptide 8 (42 aa)
MSDHPPIAFQQRSVSVDLEESPLCLESSPSHCRWCLNFRLPM*

Sequence

>CNT3036798
CGACTATAAATATAAATTTATACTTATATTTATGAAAATTTTCCTTTTTGATCTTTGTTTATACAAAATACTATATTATTTATAACATTTATTTTAGAAA
TTGTCTCTGACCCATTAGGCCATTACAACATATTACATTTATAACAAACTAAAATAAAAGTAGTTGAGTCCAGTTTTATTACTACTAAACCATCCAGAAG
GGACAGAGGACATCGGGGCCGCCTAAAAGCCACCACGCAGGCGGAGGACAAGGTGGAGGGTGGACTCTTTCTGGATATTGTAATCAGCCAATGTCCGACC
ATCCTCCAATTGCTTTCCAGCAAAGATCAGTCTCTGTTGATCTGGAGGAATCCCCTCTTTGTCTTGAATCTTCGCCTTCACATTGTCGATGGTGTCTGAA
CTTTCGACTTCCAATGTGATTGTCTTCCCTGTTAACGTCTTCACGAAAATCTGCATTCCACCGCGCAATCGGAGCACTAAATGCAACGTTGATTCCTTTT
GAATGTTATAATCTGCTAGAGTCCTGCCATCTTCAAGCTGCTTACCAGCAAAAATCAACCTCTGTTGGTCCGGTGGAATACCTTCCTTGTCTTGTATTTT
AGCCTTGACATTGTCAATGGTATCAGAACTCTCCACCTCAAGAGTGATGGTTTTGCCAGTAAGGGTCTTCACAAATATTTGCATCCCACCGCGAAGTCTA
AGCACCAAATGGAGTGTAGATTCCTTTTGGATATTGTAATCGGCAAGCGTTCGGCCGTCCTCAAGTTGCTTACCAGCAAAGATAAGCCTCTGTTGGTCGG
GTGGAATGCCCTCTTTATCTTGAATCTTTGCCTTAACATTGTCAATTGTATCAGAGCTTTCCACCTCGAGGGTGATTGTTTTGCCAGTGAGAGTTTTTAC
GAATATTTGCATCTGTTAAGAAACCAATTCAACGCATGGCCTCAATATGAAAACGTCATAACATAAATAGCTCAAGAACCAAATCTATATACAAAAAGTC
CAATCAAATTGATAAATTAGAAGAAATCATGTACAAAATTTTGAAATCTTCAACTTCTCAGTACAATCTTTTTGCTCTTATTTGGGAAAGCCAAACTATG
AACTGGGATTGAATACGGGTTCTTATTTACACAGGAGAAAAGGATAACATTCCAAGGAGCTCGGGAATTGAAAACGAATAAAAATAGAATTGATTTTTGT
AGAAAAATGAAGAGAGAAAACAGAGAAACTCCAAGAAACGCAAAATCAATAGGGGAGGAAAACAACAAGGGAAGCGATACGCAGCAACACGAAAAACGAA
ACAGAAATAAAAATGGAACGACAAGGAATTGAACGAATTATACAATCCATTAAAAAGTTAGGAAGGAACTTTAACTTCTCAGTTCAATTTTTCAATCAAA
CACCCTTACCTCACTTCTTGGTTCCATCCTAACGGTGTAGAACATCTCATCGAATCGAATATATAAAAGTTGGAGATAAAAAACCAACTTCTTATTTGCA
AAAACTAAACAATAGATTGAGATCATTATCTACAAGATCTAATAACGTATGCCGTGGGAAAAAAAACAAACACGATTTCAATCGTTTCTTTGTGAAAGAT
GTAAGAAAACGGAGAAATTAAAATCAACCCACAAAAAGCGTTCTAAAATCGAACTAGAAGGGAGAAAAACAACAAGGGAAACGATTAAACAACAACTCTA
ACAAAAAAAGAGATTGAATAACAAAGAATTAAACAAAGCCAACTTCAAACGTCCCTCAAATCCAAGAGATCAACAGAGAAAGAAAACTAGAACTGAAATA
TACCTTTAGATGAAGAAAAAGCACGACGAAATGGGAAAAGCAGGCTTTGAAGGAAAATTTGGAAGACAAAGGATTAGGGATAAGGAGGGGGTGAATTTAT
AGGAGCCAAAATACCAAAATGCCAAAATTAAGGGAGGAGGTTTAGAGGAAGAAACGAATTTTAATGGGGGTCCTTGGTCTGCAAGCCACGATTTGGAGAA
CTTCGCTGGGGATTCTAGAAACTTCCGGAAACGTACACACCTTTATTTAGGGTTTAACTTTAGCACCCTAATCAGGGGAAATTGTACAAAGTAGCACCTT
TAGTTTTAGGGATTTGAAATTGAAACAAATTTATCGATTTTAGA