Detailed information on CNT3036653


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE: nothing found

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT3036653

Peptides detected in this lncRNA

>peptide 1 (64 aa)
MCLTSLGSAVFCGMYNSLYTRLASSSHESFKQSRQIQVQKNVVRRLHAIFRSKVAGSPGGGVTC*

>peptide 2 (40 aa)
RGIRFICLQVSFRGSQNEDFDIKNTHLGREELNRAYRPRI*

Sequence

>CNT3036653
CGGGGAATCAGATTTATATGTCTTCAGGTAAGTTTTAGAGGATCTCAAAATGAAGATTTTGATATAAAGAACACTCATTTGGGCCGAGAAGAATTAAACC
GAGCTTATAGACCAAGGATCTAGCCCAAGACTGTAGAGATCGACTTCCCGGTGCCTGATAGACTGCCTTAGTCTGCGGAAGCTTCATTATCGATTGCCAG
TACGTGTTTTGAGTTGGGCATAAAGTCTGTTGTGTTGTGATGTATTCACACCCTTGTATGTTATAGATACTCCACAGTTTGTATAAGCTTTAGGAGCTGT
AGTTGTGTAAATTTTGTTGGTTATATTTTGATTAAGGTGTCTTTAGGTTTACTCGTGAAATCGGTAAATTTTGAGGTACACTTCATGTATGTGTTTGACT
AGCCTAGGATCCGCTGTGTTTTGTGGCATGTACAATAGTTTATATACTAGATTGGCAAGTTCATCACATGAAAGTTTTAAGCAGAGTCGACAGATACAGG
TACAGAAAAACGTTGTTCGTCGGCTTCACGCCATCTTTCGGTCTAAGGTAGCAGGTAGTCCGGGAGGGGGTGTGACATGTTAATTGTTTGTGTATAACCA
TGTTTGTTGGTTGAAATTTTGTCTATTTGGGGTGAAATGGGTGTGTAGATTGCTGGTTTTTTGTTTATGTATTCGAGATAATTGTTGTTCTATTGTTATT
CTTTTTTGTTTAGTGTAGTTCAATTTTTGGGCCTCTTTTTATTTGAGGCTATGTATATTGAGG