Detailed information on CNT3036538


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONBNAT007269, E-value = 9e-96

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT3036538

Peptides detected in this lncRNA

>peptide 1 (63 aa)
HVPLGAERPLLLVGNRAISTCVASSPDSDLEAFSHNPAHGSFAPLAFQPSAMTNCANQRFLSY*

Sequence

>CNT3036538
CACGTGCCTTTGGGGGCCGAAAGGCCCCTACTGCTGGTCGGCAATCGAGCGATAAGCACATGCGTCGCTTCTAGCCCGGATTCTGACTTAGAGGCGTTCA
GTCATAATCCAGCGCACGGTAGCTTCGCGCCACTGGCTTTTCAACCAAGCGCAATGACCAATTGTGCGAATCAACGGTTCCTCTCGTACTAGGTTGAATT
ACTATTGCGACACTGTCATCAGTAGGGTAAACTAACCTGTCTCACGACGGTCTAACCCC