Detailed information on CNT3036037


BLAST search results

BLAST vs Swiss-Prot:
sp|P0CH05|UBI2P_PETCR, E-value = 3e-100

BLAST vs NONCODE:
NONMEST001181, E-value = 5e-99

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30201346Cucumis meloPisum sativum99.8356.384.85581forward
CNT30311067Cucumis meloCamelina sativa99.834686.23581forward
CNT30613113Cucumis meloArabis alpina100.1763.4484.56583forward
CNT3051082Cucumis meloCucumis sativus100.1780.5296.74583forward

Expression of CNT3036037

Peptides detected in this lncRNA

>peptide 1 (48 aa)
LLDVVVSQSPSIFKLLSSEDQPLLVWWDSLLVLDLSLDVVDGVRALNL*

>peptide 2 (53 aa)
MPSLSWILAFTLSMVSDDSTSRVMVFPVRVFTKICMPPRRRRTRWRVDSFWML*

>peptide 3 (33 aa)
MVSELSTSRVMVFPVNVLTKICIPPRRRNTSGG*

>peptide 4 (35 aa)
PSGCCSQPESFHLQAAFQRRSTSAGLVGFPPCLGS*

Sequence

>CNT3036037
TCCTTCTGGATGTTGTAGTCAGCCAGAGTCCTTCCATCTTCAAGCTGCTTTCCAGCGAAGATCAACCTCTGCTGGTCTGGTGGGATTCCCTCCTTGTCTT
GGATCTTAGCCTTGACGTTGTCGATGGTGTCAGAGCTCTCAACCTCTAGGGTGATGGTCTTTCCGGTCAACGTCTTGACGAAAATCTGCATACCACCACG
AAGACGCAACACAAGTGGAGGGTAGACTCCTTCTGGATGTTGTAGTCGGCCAAAGTGCGGCCATCCTCGAGTTGCTTTCCAGCGAAGATAAGACGCTGTT
GGTCTGGGGGAATGCCTTCTTTGTCCTGGATCTTGGCCTTCACGTTGTCAATGGTGTCAGACGACTCAACCTCAAGGGTGATGGTCTTTCCGGTCAGGGT
CTTCACGAAAATCTGCATGCCACCACGAAGACGGAGGACAAGGTGGAGGGTGGACTCCTTCTGGATGTTGTAGTCGGCCAAGGTACGGCCATCCTCGAGT
TGTTTACCGGCGAAGATGAGACGTTGCTGATCCGGGGGAATCCCTTCCTTGTCCTGGATCTTGGCCTTGACGTTGTCGATCG