Detailed information on CNT3035914


BLAST search results

BLAST vs Swiss-Prot: nothing found

BLAST vs NONCODE:
NONCQUT004405, E-value = 0.0

Results of reciprocal BLAST search (potential orthologs)
nothing found

Expression of CNT3035914

Peptides detected in this lncRNA

>peptide 1 (31 aa)
DSVEPGIVIYCHYLPVSGLGNLRACCLPWMW*

>peptide 2 (54 aa)
MMRRRHDGRAIRRVIMNHQSNGQSPRRPFIYKCIPSRSRGLLHVLALELLRLSE*

>peptide 3 (44 aa)
MHPFQKSGFVARISSRITTVIRVADTIKQTITDLMSHSQFHSLN*

Sequence

>CNT3035914
CAGACTCTGTAGAGCCCGGTATTGTTATTTATTGTCACTACCTCCCCGTGTCAGGATTGGGTAATTTGCGCGCCTGCTGCCTTCCTTGGATGTGGTAGCC
GTTTCTCAGGCTCCCTCTCCGGAATCGAACCCTAATTCTCCGTCACCCGTCACCACCATAGTAGGCCACTATCCTACCATCGAAAGTTGATAGGGCAGAA
ATTTGAATGATGCGTCGCCGGCACGATGGCCGTGCGATCCGTCGAGTTATCATGAATCATCAGAGCAACGGGCAGAGCCCGCGTCGACCTTTTATCTATA
AATGCATCCCTTCCAGAAGTCGGGGTTTGTTGCACGTATTAGCTCTAGAATTACTACGGTTATCCGAGTAGCAGATACCATCAAACAAACTATAACTGAT
TTAATGAGCCATTCGCAGTTTCACAGTCTGAATTAGTTCATACTTACACATGCATGGCTTAATCTTTGAGACAAGCATATGACTACTGGCAGGATCAACC
AGGTAGCATTCCTACACGAC