Detailed information on CNT3035650


BLAST search results

BLAST vs Swiss-Prot:
sp|Q96552|METK2_CATRO, E-value = 1e-168

BLAST vs NONCODE:
NONPOPT000587, E-value = 6e-79

Results of reciprocal BLAST search (potential orthologs)
TargetQuery speciesTarget speciesQuery coverage (%)Target coverage (%)IdentityAlignment length (nt)Orientation
CNT30673492Cucumis meloSetaria viridis27.7438.486.9374forward
CNT30520816Cucumis meloSetaria italica30.1947.1183.78407forward
CNT30641080Cucumis meloNymphaea colorata20.731.1786.38279forward
CNT30549907Cucumis meloIpomoea triloba16.8442.2785.02227forward
CNT30698521Cucumis meloQuercus lobata18.7745.184.19253forward
CNT30373104Cucumis meloArabidopsis thaliana28.1245.1786.81379forward
CNT30618114Cucumis meloSesamum indicum16.3948.8982.35221forward
CNT30266655Cucumis meloChenopodium quinoa30.4236.4885.85410forward
CNT3021108Cucumis meloCitrullus lanatus38.531.5394.8519forward
CNT30729630Cucumis meloCorchorus capsularis22.8537.6186.04308forward
CNT30381460Cucumis meloManihot esculenta31.946.7983.72430forward
CNT30402638Cucumis meloBeta vulgaris36.4238.3386.15491forward
CNT30524850Cucumis meloPhaseolus vulgaris2750.4284.34364forward
CNT30628391Cucumis meloVigna unguiculata37.7644.3883.89509forward
CNT30495282Cucumis meloOlea europaea30.1923.1183.78407forward
CNT30712013Cucumis meloGlycine max27.7483.6784.49374forward
CNT3047443Cucumis meloPrunus dulcis19.9622.5588.85269forward
CNT30158121Cucumis meloPistacia vera18.3239.5288.66247forward
CNT30638840Cucumis meloCapsicum annuum15.824.9486.38213forward
CNT3090332Cucumis meloSolanum tuberosum21.8845.3887.46295forward
CNT30188757Cucumis meloSecale cereale24.4174.2782.98329forward
CNT30294498Cucumis meloTriticum aestivum23.6639.9284.95319forward
CNT30225924Cucumis meloHordeum vulgare23.5956.4884.59318forward
CNT30389985Cucumis meloTriticum turgidum35.3146.883.4476forward
CNT30561874Cucumis meloActinidia chinensis23.5936.0587.74318forward
CNT3086110Cucumis meloVigna radiata24.2629.2583.18327forward
CNT30508545Cucumis meloSolanum lycopersicum13.2843.2486.03179forward
CNT30174161Cucumis meloTrifolium pratense29.3850.1982.32396forward
CNT30144304Cucumis meloMedicago truncatula31.7566.5684.58428forward
CNT30441436Cucumis meloAegilops tauschii18.448.9286.29248forward
CNT30667060Cucumis meloTriticum dicoccoides22.2647.2482.33300forward
CNT3082721Cucumis meloBrassica juncea10.3948.4487.86140forward
CNT30471855Cucumis meloSaccharum spontaneum28.3441.5286.13382forward
CNT3013982Cucumis meloZea mays19.0788.6283.66257forward
CNT30608385Cucumis meloGossypium raimondii23.5957.8283.33318forward
CNT30218287Cucumis meloKalanchoe fedtschenkoi19.2950.183.08260forward
CNT3066706Cucumis meloLeersia perrieri6.9727.6586.1794forward
CNT30650282Cucumis meloRosa chinensis30.8635.3187.26416forward
CNT30212612Cucumis meloHelianthus annuus16.5492.5382.51223forward
CNT30624603Cucumis meloDaucus carota22.2645.4586300forward
CNT30686785Cucumis meloTriticum urartu30.1240.284.48406forward
CNT30349162Cucumis meloEragrostis tef29.7544.0283.29401forward
CNT30477100Cucumis meloArabidopsis halleri12.9844.385.71175forward
CNT30368076Cucumis meloSorghum bicolor27.7434.3486.63374forward
CNT30620815Cucumis meloCajanus cajan12.3922.8583.83167forward
CNT30597062Cucumis meloOryza meridionalis28.1934.5585.79380forward
CNT30358838Cucumis meloLactuca sativa17.9535.3883.47242forward
CNT30429132Cucumis meloPapaver somniferum36.9431.480.32498forward
CNT30571189Cucumis meloVitis vinifera16.9937.1888.65229forward
CNT3055164Cucumis meloAmborella trichopoda22.8526.7881.17308forward
CNT3022562Cucumis meloPopulus trichocarpa34.5729.883.69466forward
CNT30331991Cucumis meloDioscorea rotundata15.3643.7684.54207forward
CNT30148817Cucumis meloBrachypodium distachyon28.9333.7485.64390forward
CNT30101810Cucumis meloOryza rufipogon30.4216.1785.61410forward
CNT30116702Cucumis meloOryza nivara25.1533.0184.37339forward
CNT30174424Cucumis meloVigna angularis30.6450.882.81413forward
CNT30113329Cucumis meloFicus carica20.772686.79280forward
CNT30725315Cucumis meloLupinus angustifolius37.0949.784.4500forward

Expression of CNT3035650

Peptides detected in this lncRNA

>peptide 1 (89 aa)
MLFEVCGDFVIGDGFVVLGGDQNCVDTDGYHGAIVVVVFNSDLGLAIRSQPGAGAILSNFSEASIQGFHQWHSQTCALGHQRQSPQGAL*

>peptide 2 (79 aa)
MMILRPVRPASPWGPPMTKRPEGLRWKMVFSSRYFSGMTGLMTCSLRSVAISSLVTVSSCWVEIRTVWTRTGTMAPLSL*

>peptide 3 (42 aa)
FPCRGSSRFCMYRRKRIVALAHRWRKRLGQCTYVQAHWRQCS*

>peptide 4 (31 aa)
MLTRTLQLSASRPTSSETNPMFRHVSRTIFS*

Sequence

>CNT3035650
TTTCCTTGTCGGGGATCTTCCCGGTTTTGTATGTATCGACGAAAACGGATAGTGGCTCTGGCACACCGATGGCGTAAGAGACTTGGACAATGCACCTACG
TGCAAGCCCACTGGCGACAATGCTCTTAGCAGCCTGTCTCACAATGTAGGCACCACTCCTGTCGACCTTGGTGGGATCCTTTCCGGAGAAAGCACCACCA
CCGTGAGCTCCCCAACCACCGTAGGTGTCGATGATGATCTTGCGTCCGGTAAGACCTGCATCACCATGGGGGCCACCAATGACGAAACGGCCTGAAGGGT
TAAGGTGGAAGATGGTCTTCTCGTCGAGGTACTTCTCGGGGATGACTGGCTTGATGACATGCTCTTTGAGGTCTGTGGCGATTTCGTCATTGGTGACGGT
TTCGTCGTGTTGGGTGGAGATCAGAACTGTGTGGACACGGACGGGTACCATGGCGCCATTGTCGTTGTAGTATTCAACAGTGACTTGGGTCTTGCCATCA
GGTCTCAACCAGGGGCAGGTGCCATTCTTTCTAACTTCAGTGAGGCATCAATTCAGGGGTTTCATCAGTGGCATAGCCAAACATGTGCCCTTGGTCACCA
GCGCCAATCTCCTCAGGGCGCTTTGTGAAGTGGCCGTGAACACCCTGAGCAATATCTGGGCTCTGCTGCTCAATGTTAACCAGGACCTTGCAGTTGTCAG
CATCAAGACCGACATCGTCAGAAACGAATCCAATGTTTCGGCATGTGTCACGAACAATCTTTTCATAGTCCACATTGGCCTTGGTGGTGATCTCTCCAAA
GACCATGACCATGTTAGTCTTGCTGCAGGTCTCACAGGCGACCTTGCTGTCGGGGTCCTGAGCTAGGCAGGCGTCAAGCACCGCATCGGAGATCTGGTCA
CAGAGCTTGTCGGGGTGACCCTCATTTACGGATTCAGAGGTAAATAGAAAGGTCTCCATCTCTGAAACATAACAAAACACCATATTAGTTCGTGTACAAA
AAACATTCAGTTCATTAGTTAAGTTTTAGTCACATCAGTATTGCTTAAGCTTGAAAATATCAACAGTTACCACATAGCACACTTGAAATCAAGATAGGTT
TATAGAAATCTGGGTAATACAAGCACAGATTCAGAAGATTCAAATAAAATTATAGATACTTTTAATGAATGGAAATGACTCGACGAATCTGAACAACCAA
ACAGGTTCAAAATCAGGGAAACAACAAAATTAAAATTATAAAACACAAGATCTGCCCTAAGGAATCCTACACTCATGTAGAAGATGACTGGATCTACAAT
TCAACCACAGTAACAGTCCCTTACCAAATCCAATTACCGACAAAAAAC